The room was anchored by this spectacular chandelier that we created from @shopwildthings1/4Decor Love the idea of putting the tribute videos in screens in the walls. #EventOfTheDay

A photo posted by Colin Cowie (@colincowie) on Oct 4, 2016 at 7:28am PDT

The room was anchored by this spectacular chandelier that we created from @shopwildthings1/4Decor Love the idea of putting the tribute videos in screens in the walls. #EventOfTheDay

A photo posted by Colin Cowie (@colincowie) on Oct 4, 2016 at 7:28am PDT

The room was anchored by this spectacular chandelier that we created from @shopwildthings1/4Decor Love the idea of putting the tribute videos in screens in the walls. #EventOfTheDay

A photo posted by Colin Cowie (@colincowie) on Oct 4, 2016 at 7:28am PDT

The room was anchored by this spectacular chandelier that we created from @shopwildthings1/4Decor Love the idea of putting the tribute videos in screens in the walls. #EventOfTheDay

A photo posted by Colin Cowie (@colincowie) on Oct 4, 2016 at 7:28am PDT

#sweetdreams thinking about the #americanfriendsoftheisraelmuseum #gala just the other night at #cipriani25broadway . It was a great honor to be there by your sides once again! @friendsofisraelmuseum @cipriani #davidstarkdesign #event #events #eventdesign #eventDecor #eventplanning #eventplanner #design #Decor #installation #installationart #artinstallation #inspirationiseverywhere 📸 by @msusiem

A photo posted by David Stark (@david_stark_design) on Nov 7, 2016 at 4:20pm PST

And THIS is why we think that we have the sweetest and most talented customers in the world ❤️💜💙💚Reposted from @cherluxuryDecor : Beautiful Square crystal columns from @shopwildthings1/4Decor! We love the walkway. #eventplanner #eventdesign #crystalcolumn #aisleDecor #beadedcolumns #weddingdesign #weddingwalkway

A photo posted by ShopWildThings (@shopwildthings1/4Decor) on Aug 5, 2016 at 7:08pm PDT

We carry cake stands adorned with crystal beads and handsome centerpiece risers. We have antiqued gold and white combination cake and cupcake stands. Impress the guest list with antique silver and crystal three-tier display stands. Browse our contemporary cupcake towers and classic stands edged with crystals and roses.

A favorite for exceptional weddings is our tree stand in silvery aluminum that will create a stunning centerpiece even after the desserts it holds are gone. Go for the bold with our zebra cardboard cake stands in black and white. Create a birthday party sensation with an Under the Sea cupcake holder decorated with colorful dolphins, whales and sea turtles. We also have a great collection of tubes and plates to help you create your own design.

We carry affordable ostrich spads in lengths that will range from about 29 inches to 32 inches each. The width or spread of each feather you order will be approximately 7 inches. Our white ostrich feather spads will each range in length from 23 inches to 26 inches. Because they are thinner than mature plumes, bleach absorption will vary. Some will appear white, while others will appear off-white in color. We think the range in shades only adds to the all-natural appeal of these white ostrich spads. Because of frequent damage in return shipping, we regret that this item is not returnable]]>wild-pagerewophonmtv11https://s.yimg.com/aah/shopwildthings/featured-designer-tamara-wendt-led-lighting-decor-essentials-52.jpghttps://s.yimg.com/aah/shopwildthings/featured-designer-tamara-wendt-led-lighting-decor-essentials-53.jpg Tamara Wendt Design, is already wowing us with stunning looks for event planning fairs, not to mention a full season of weddings. We love to see the original uses that she finds for decor staples ~ to our way of thinking, it’s this ability to put fabulous pieces together in innovative ways, week after week, that really make a professional event planner worth every penny (and more). For instance in the main photo, take a look at the way that Tamara combines Chandeliers, feathers, candles, and LED lighting for a space that is high style and high energy. The cobalt blue downlighting shown here lends a dramatic nightclub feel to the event space, and the LED Uplighting is a subtle touch that makes a major impact with a minor effect on the budget. Hint: There are LEDs inside the vases with the ostrich feathers and in the chandelier riser centerpieces, which make a great counterpoint against the strong blue event lighting. If the whole chandelier-as-centerpiece-on-a-riser-with-LED thing sounds super-duper-complicated, check out these Centerpiece Kits and for a demo on how to take apart and put back together, check out this video. Totally doable, truly transformative, and budget-friendly to boot. In the 2nd photo, we love Tamara’s use of lighted spheres, LED-lit cubes, and this stunning indoor tent to create architectural interest and a soft, sexy space within a large ballroom. What a cool way to put your event’s distinctive stamp on a large venue and the tiers of warm candlelight from Votives and Wine Glass Vases work with cooler LED lighting in and around the tent. The 3rd photo shows another look at the formidable combination of bead curtains, chandeliers, and LED and event lighting. And the best part? These reusable items are some of the most cost effective event decor solutions that you can find. We know that Tamara’s a genius because we *know* that she takes many of the same basics and uses them to change the look of event space after event space, week after week. (Visit Tamara Wendt Design on Facebook, and you can see how she delivers custom, personalized events, week after week.) A lot of these are our products, and we’re *still* amazed at how different they look in the hands of a gifted event designer. Did you want to see a closeup of those gorgeous tables in the 4th photo? Who guessed crystal strands draped in a Manzanita Tree, embellished with hot pink florals and votives? And btw, we never get sick of hot pink. The final photo shows one last tablescape, using the same chandelier centerpiece kit and the same wine glass vases that you’ve seen in the photographs above, combined with a gorgeous suspended chandelier and luxe table linens. Totally romantic, and a completely different look in this setting. Whether you’re an experienced design professional, or you are just beginning to imagine that you can translate a unique vision for an event space, we know that you will find a multitude of uses for LED lighting and decor essentials at your events, week in and week out. We pride ourselves on supplying the best quality products along with great customer service, and we’d love to see how you use Shop Wild Things decor solutions in your events. All images courtesy of Tamara Wendt Designs; all of the weddings and events designed and coordinated by Tamara Wendt are produced by A One Event Rental.]]>wild-pagerewophonmtv11https://s.yimg.com/aah/shopwildthings/festivities-wedding-reception-decor-ideas-47.jpghttps://s.yimg.com/aah/shopwildthings/festivities-wedding-reception-decor-ideas-48.jpgIf you need to Decorate for a wedding reception, why not consider beaded curtains and chandeliers hung from the ceiling, around the room, behind the cake table, and behind the head table? They add tons of glitz and glamour to the room without competing with your theme colors. You can make our Crystal Beaded Curtains and Crystal Chandeliers any color you'd like by simply aiming your choice of colored light at them! If you use no colored light, they will just sparkle and shimmer as shown in these spectacular photos shared by Tina over at Festivities in Ormonde Beach, Florida. The ceiling treatment shown in the photos was made by Festivities using our beaded curtains and attaching the rods at the ends, but we also sell a ceiling drape and canopy that's ready to hang...see the links below! The lighting on top of the chandeliers that were used as centerpieces are our LED Light Discs. We also sell kits that include a Riser for your Chandelier Centerpiece. Below are many of the items used to create this beautiful event.wild-pageprom-homecoming-dance-decorations1https://s.yimg.com/aah/shopwildthings/fiber-optic-clip-on-light-14-b-o-set-of-12-76.jpghttps://s.yimg.com/aah/shopwildthings/fiber-optic-clip-on-light-14-b-o-set-of-12-77.jpgFeathers, flowers, floral arrangements, wreaths, tree branches or light up Terrariums, clear vases and Cinderalla Carriages. Note: these are not waterproof. Lighting up Decor really doesn't get any easier - attach, toggle on, done! And it's amazing how this little light can make wedding and event centerpieces come to life. Place in a Glasss Dome with a single rose - simple and elegant! To replace the batteries, carefully slide your fingernail under the side holding the clip, and gently pry off the top.]]>wild-pagelimegreendecor3https://s.yimg.com/aah/shopwildthings/ficus-spray-25-bendable-greenery-branch-44.jpghttps://s.yimg.com/aah/shopwildthings/ficus-spray-25-bendable-greenery-branch-45.jpgThere is a minimum order of 3 sprays. The shorter stem on this branch allows it to be used in shallower vases like a Mermaid Vase, while letting the leafy stems dangle down. Flowers are such an essential element for weddings, special events and everyday decor, but adding greenery enhances any display and completes the visual. Top event planners and designers are taking advantage of every part of their venues by adding overhead floral chandeliers to completely surround guests in luscious natural foliage and this spray is an ideal addition for lavish draping designs. To create a perfect ceremony setting and photo backdrop, use this ficus branch on a Wedding Chuppah Gazebo that has pre-drilled holes, ready to hold an abundance of floral and greenery sprays. Beautiful, effortless, versatile and reusable. Just the kind of decor a busy planner or decorator dreams of!]]>wild-pagerewophonmtv11https://s.yimg.com/aah/shopwildthings/filling-the-air-with-the-greatest-of-ease-large-decor-items-52.jpghttps://s.yimg.com/aah/shopwildthings/filling-the-air-with-the-greatest-of-ease-large-decor-items-53.jpgCandles, as your intended watches from a dais embellished with crystal columns. Actually, you don't have to imagine: Just check out the effect that Colin Cowie achieved in the main photo. Using some of the same key elements ~ candlelight and square crystal columns ~ Colin Cowie ties the ceremony and reception areas together beautifully. Adding to the already stunning architecture of the room, these pieces set the stage for a grand affair. These crystal columns can be ordered in custom lengths to accentuate the structure of any classic or modern event space, and they're a great way to enhance the dramatic effect of high ceilings. A closeup of the Crystal Columns shows the way that color can be added with event lighting Ñ one of the things we love about these columns is how versatile they are, taking on the color that you select. For event planners, they are the ultimate in reusable large scale event Decor. (We love the gorgeous custom design with the couple"s initials, too. Such a bold, timeless touch. We Southerners can't help but think that the monogram would look pretty swanky on pillows and towels, too.) we're suckers for Candlelight and ostrich feathers. Besides being stunning ways to fill giant venues effectively, they're extremely cost effective, as they're 100% reusable. Hello, jaws dropping *and* happy planet. In the last photo, an off-to-the-side view of the bar shows how well integrated the entire event"s Decor is. The effect of the event lighting is clear on the left side of this image. And we kinda think you can't go wrong with Ostrich Feathers in a bar. Whether you're working on your breakthrough event at an A-list venue, experimenting with portfolio work that will launch you into the stratosphere of event planning, or building a set of strategies to fill big spaces on a budget without looking like corners were sliced and diced, we think that large Decor items are staples that every planner should stockpile due to their versatility, value, and overall wow factor. Crystal columns and ostrich feathers are some of the most flexible, impactful, and all around stunning pieces that we carry. Throw in some candle light and a chandelier or ten, and you have an event to remember even for the most jaded VIP guests. Whether this is your first or your 101st wedding or event, we'd love to talk to you about how our stunning Decor staples can transform your venues while yielding fantastic value for your clients.]]>wild-pagerewophonmtv11https://s.yimg.com/aah/shopwildthings/firefly-occasions-calgary-ab-canada-beverly-hills-ca-27.jpghttps://s.yimg.com/aah/shopwildthings/firefly-occasions-calgary-ab-canada-beverly-hills-ca-28.jpg ]]>wild-pagerewophonmtv11https://s.yimg.com/aah/shopwildthings/five-diy-fall-centerpieces-that-are-high-on-style-and-easy-on-budgets-52.jpghttps://s.yimg.com/aah/shopwildthings/five-diy-fall-centerpieces-that-are-high-on-style-and-easy-on-budgets-53.jpg Centerpiece One: Candlelight, Nature, and Texture Meet We love the way that this long, layered centerpiece combines elements found in nature and at your local farmer"s market (small pumpkins and gourds, ferns, and berries) with tall ivory candles in varying sizes. Add a Burlap Runner and perhaps some moss and a few sprays for color and you have a lovely organic centerpiece that will last throughout autumn. No time for a total redo for Christmas? Replace the pumpkins with poinsettias and pinecones, and this pretty arrangement could stay put well into the new year. (PS: If you haven't read Anita"s blog, it's the kind that really sucks you inÉ Her words are genuine and her projects are inspiring in an in-my-next-life-I'll-refinish-my-own-wormy-chestnut-countertops kind of way.) Centerpiece Two: Modern Lines in a Spare Fall Centerpiece The simple, authentic feel of this centerpiece wins us over completely. No experience arranging florals is required, because the sturdy trio of pumpkins is a forgiving base for Tall Branches in a high vase. Add a bowl of nuts (or even acorns) for balance, and your table is ready for company. (Swap the pumpkins for some heavy Christmas balls, and this centerpiece can greet Santa in style.) Centerpiece Three: Traditional Pumpkins in Non-Traditional Colors For an original twist on a tried and true fall color scheme, we love these white pumpkins with fiery fall colors in the red and yellow Sprays or Beaded Garland and orange runner. Beads and votives complete this original interpretation of a classic fall table. Centerpiece Four: A Tempest in a Vase You can't beat this centerpiece for charming simplicity ~ we could assemble everything inside the vase in our yard right now. Well, if it weren't dark. Choose some pretty fall leaves and pinecones, a vase or three, and you have a delightful centerpiece. Best of all, label that vase when you pack your seasonal Decor away, and you can recreate this centerpiece on no budget at all next year. Centerpiece Five: An Array of Fall Goodies Finally, we love this layered take on a fall centerpiece. It has just the right balance of whimsy and weight, and we're suckers for a visually appealing hodgepodge of favorite things. (And for any display that includes striped candy sticks.) Combining a tall glass vase, branches and/or sprays, some votives, Table Scatter and pumpkin-filled stands is more doable when you have a model to go by, and InspiredByCharm provides a great example here. (We love to see patterns applied to burlap runners, and these shiny polkadots look like a reasonable DIY option.) So if our opening paragraph and the whole three-weeks-from-Thanksgiving-til-Christmas thing freaked you out a bit (as it did us when we realized, say, two days ago), we hope that we've redeemed ourselves by giving you some high impact, low cost ideas for dressing your table for the coming holidays.]]>wild-pagepipe-and-drape-backdrops11Diamonds Crystal Sparkling Columns which are so gorgeous and really make the difference in taking your venue decorations over the top. If you have your own base plate and crossbar, just make sure the column diameter fits the crossbar, or if you prefer, we have bundled these items together to insure everything fits properly: 9' Tall Fixed Height Freestanding Riser with Base and Crossbar. ]]>wild-pageledupwawava11https://s.yimg.com/aah/shopwildthings/flame-lamp-battery-operated-amber-and-blue-tabletop-or-hanging-66.jpghttps://s.yimg.com/aah/shopwildthings/flame-lamp-battery-operated-amber-and-blue-tabletop-or-hanging-67.jpgThe awesome silk flame of this cool Flame Lamp is really set off by the Amber and Blue Colored LED lights. These lights create quite beautiful glow when you turn on the unit. An internal fan blows to move the silk and it really looks so much like a real flame. You AND your guests will do a double-take! The bowl 10" Wide x 4.5" tall. The Flame, when turned on, stands almost 8" tall. The The LED lights stay cool to the touch so you won't have to worry about anyone getting hot hands. The old style of these flame lamps used Halogen lights which got very hot. Our new flame lamp now comes with a flat-bottom bowl so that you can use it on the table. You'll also get a chain for hanging applications. This unit is battery operated with a 7 hour battery life on 4 D Batteries (batteries are not included). Create a super-exotic look for your next event or even in your home, office, or recreation room! You can also add a 6V DC Adapter for permanent installations. AC Adapter is not included but can be purchased at most hardware stores.wild-pagewhclde1https://s.yimg.com/aah/shopwildthings/small-floating-candles-bulk-weddings-24.jpghttps://s.yimg.com/aah/shopwildthings/small-floating-candles-bulk-weddings-25.jpgMirrors. Classy and exquisite, submerge flowers in a clear glass vase and float a candle or two on top. Easy and a great time saver for last minute get-togethers. You can also sit these on water jelly Decor, diamond confetti fill, or if using clear water, use colorful Submersible LED Lights to match your theme. If you have a larger vase, bowl or even a fountain, float candles and foam roses. How elegant!]]>wild-pagewhclde2https://s.yimg.com/aah/shopwildthings/shopwildthings-2-inch-floating-candles-26.jpghttps://s.yimg.com/aah/shopwildthings/shopwildthings-2-inch-floating-candles-27.jpgThere is a minimum order of 2 Sets, 4 Pieces per Set. Romantic floating candles create the perfect ambiance and the subtle glow looks dreamy floating on water or simply placed on Mirrors. Classy and exquisite, submerge flowers in a clear glass vase and float a candle or two on top. Easy and a great time saver for last minute get-togethers. You can also sit these on water jelly Decor, diamond confetti fill, or if using clear water, use colorful Submersible LED Lights to match your theme. If you have a larger vase, bowl or even a fountain, float candles and foam roses. How elegant!]]>wild-pagewhclde1https://s.yimg.com/aah/shopwildthings/floating-candles-shopwildthings-26.jpghttps://s.yimg.com/aah/shopwildthings/floating-candles-shopwildthings-27.jpgburn time is 7-8 hours. Romantic floating candles create the perfect ambiance and the subtle glow looks dreamy floating on water or simply placed on Mirrors. Classy and exquisite, submerge flowers in a clear glass vase and float a candle or two on top. Easy and a great time saver for last minute get-togethers. You can also sit these on water jelly Decor, diamond confetti fill, or if using clear water, use colorful Submersible LED Lights to match your theme. If you have a larger vase, bowl or even a fountain, float candles and foam roses. How elegant!]]>wild-pagewhclde2https://s.yimg.com/aah/shopwildthings/small-floating-candles-wholesale-25.jpghttps://s.yimg.com/aah/shopwildthings/small-floating-candles-wholesale-26.jpgThere is a minimum order of 2 Sets, 12 Pieces per Set. Romantic floating candles create the perfect ambiance and the subtle glow looks dreamy floating on water or simply placed on Mirrors. Classy and exquisite, submerge flowers in a clear glass vase and float a candle or two on top. Easy and a great time saver for last minute get-togethers. You can also sit these on water jelly Decor, diamond confetti fill, or if using clear water, use colorful Submersible LED Lights to match your theme. If you have a larger vase, bowl or even a fountain, float candles and foam roses. How elegant!]]>wild-pagewhclde2https://s.yimg.com/aah/shopwildthings/2-inch-floating-candles-bulk-packs-27.jpghttps://s.yimg.com/aah/shopwildthings/2-inch-floating-candles-bulk-packs-28.jpgThere is a minimum order of 2 Sets, 4 Pieces per Set. Romantic floating candles create the perfect ambiance and the subtle glow looks dreamy floating on water or simply placed on Mirrors. Classy and exquisite, submerge flowers in a clear glass vase and float a candle or two on top. Easy and a great time saver for last minute get-togethers. You can also sit these on water jelly Decor, diamond confetti fill, or if using clear water, use colorful Submersible LED Lights to match your theme. If you have a larger vase, bowl or even a fountain, float candles and foam roses. How elegant!]]>wild-pagewhclde1https://s.yimg.com/aah/shopwildthings/large-floating-candles-shopwildthings-26.jpghttps://s.yimg.com/aah/shopwildthings/large-floating-candles-shopwildthings-27.jpgburn time is 7-8 hours. Romantic floating candles create the perfect ambiance and the subtle glow looks dreamy floating on water or simply placed on Mirrors. Classy and exquisite, submerge flowers in a clear glass vase and float a candle or two on top. Easy and a great time saver for last minute get-togethers. You can also sit these on water jelly Decor, diamond confetti fill, or if using clear water, use colorful Submersible LED Lights to match your theme. If you have a larger vase, bowl or even a fountain, float candles and foam roses. How elegant!]]>wild-pagecolorfulcurtainsilverbendablebeadedcurtain1https://s.yimg.com/aah/shopwildthings/floating-confetti-beaded-curtains-86.jpghttps://s.yimg.com/aah/shopwildthings/floating-confetti-beaded-curtains-87.jpgOur festive confetti beaded curtains at ShopWildThings have bendable rods, which means they're a beaded curtain or a beaded column. Get the celebration started with these colorful strands of PVC acrylic squares and rectangles that make fun backdrops for wedding receptions and outdoor deck parties. Because these extraordinary confetti bead curtains have a bendable rod, you can bend them around columns, around staircases, around outside pavilion posts and around just about any stage set piece. Just use your imagination. At outdoor receptions, wrap these bending curtain rods with colorful confetti beads around tree trunks or concrete gateposts. At your weekend cabin or beach house, bend them around your fence gates or porch columns. They make amazing restaurant and nightclub focal points when you wrap our bendable bead curtains around inside support columns or service tables. You can just cut to make them to fit lower tables. Leading event planners use these attention-getting confetti-shape beaded curtains to decorate doorways and windows. Use them as charming curtains for doors or windows at galas and awards ceremonies. Celebrate a special event at your restaurant or retail store with confetti bead curtains in display areas or entrances. The curtain is 35 inches wide and 6 feet long, and it's pre-assembled with 7 strands of acrylic confetti spaced 3 inches apart on each curtain. The multiple sizes of the squares and rectangles range from 1 inch by 2 inch configurations to 3.5 inches by 3.5 inches in size. Choose white, metallic silver, multi-color curtains or a combination of black, silver and white curtain confetti. wild-pageshepherdshooks1https://s.yimg.com/aah/shopwildthings/floral-and-centerpiece-riser-39-chrome-silver-finish-76.jpghttps://s.yimg.com/aah/shopwildthings/floral-and-centerpiece-riser-39-chrome-silver-finish-77.jpgThis majestic 39" tall Centerpiece Riser has so many possibilities! It makes a fantastic statement as a focal point for event tables but also stands out beautifully as a floor unit. Use flameless LED candles, floral arrangements or top with a chandelier and LED floralytes or light discs. The diameter of the base is 8" and the bowl is 7.5" in diameter. There is a candle holder in the middle of the bowl which is 2.25" in diameter. This riser bears a resemblance to a trumpet and will add elegance and class wherever it's displayed. The entire unit easily comes apart in 4 pieces for storage. This item weighs just over 3 lbs.wild-pagevaflvaeitocy1https://s.yimg.com/aah/shopwildthings/floral-and-chandelier-centerpiece-vase-riser-gold-27-45.jpghttps://s.yimg.com/aah/shopwildthings/floral-and-chandelier-centerpiece-vase-riser-gold-27-46.jpg
This tall floral centerpiece riser is 27" tall by 7 1/2" wide with a base footprint of 6 1/4". The vase is metal and provides the foundation for a successful event and delivers on reducing stressful decorating decisions and simplifying planning efforts! The inner measurements of the large bowl are 8 1/2" deep, 3 1/2" wide at the bottom and 7 1/4" wide at the top. This large bowl is the ideal vessel for draping silk floral sprays like Wisteria Blooms, Plumeria or Amaranthus as well as upright sprays like Silk Rose Bouquets, Hydrangea Blooms, Orchids and Tiger Lilies or surround a tall flameless candle with greenery and silky florals.

To use as a centerpiece riser, Silk or Foam Pomander Kissing Balls like Hydrangeas and fanciful ostrich feathers are effortless decorating options that also add height and color. Create a chandelier centerpiece by adding a chandelier on top which also provides a framework to hold floral Decor and lights. A Real Capiz Shell chandelier or a chandelier with clear beads like Avalon looks impressive atop this riser. Then after the event, you've got a chandelier and a vase that you can use separately!

This vase looks majestic sitting on the floor or on a Wedding Pillar Column to line an aisle and can also be used to hold your favorite bottle of bubbly but there are no drain holes. Multi-functional, no maintenance and fabulous looking! This is the kind of event product that you'll be proud to own!]]>wild-pagehacaho1https://s.yimg.com/aah/shopwildthings/floral-and-chandelier-centerpiece-vase-riser-silver-27-38.jpghttps://s.yimg.com/aah/shopwildthings/floral-and-chandelier-centerpiece-vase-riser-silver-27-39.jpg
This tall floral centerpiece riser is 27" tall by 7 1/2" wide with a base footprint of 6 1/4". The vase is metal and provides the foundation for a successful event and delivers on reducing stressful decorating decisions and simplifying planning efforts! The inner measurements of the large bowl are 8 1/2" deep, 3 1/2" wide at the bottom and 7 1/4" wide at the top. This large bowl is the ideal vessel for draping silk floral sprays like Wisteria Blooms, Plumeria or Amaranthus as well as upright sprays like Silk Rose Bouquets, Hydrangea Blooms, Orchids and Tiger Lilies or surround a tall flameless candle with silky florals.

To use as a centerpiece riser, Silk or Foam Pomander Kissing Balls and fanciful ostrich feathers are effortless decorating options that also add height and color. Create a chandelier centerpiece by adding a chandelier on top which also provides a framework to hold floral Decor and lights. Crystal chandeliers like April, Avalon, Ashlynn and Shimmy Silver look impressive atop this riser. Then after the event, you've got a chandelier and a vase that you can use separately!

This vase looks majestic sitting on the floor or on wedding pillar columns to line an aisle and can also be used to hold your favorite bottle of bubbly but there are no drain holes. Multi-functional, no maintenance and fabulous looking! This is the kind of event product that you'll be proud to own!]]>wild-pagerewophonmtv11https://s.yimg.com/aah/shopwildthings/floral-wedding-chandelier-centerpiece-22.jpghttps://s.yimg.com/aah/shopwildthings/floral-wedding-chandelier-centerpiece-23.jpgOutdoor Weddings and Jewel Toned Floral Chandeliers Floral chandeliers are a top trend at luxury weddings and events, and our workhorse structural pieces make this look gettable for new designers and experienced pros alike. With the right ShopWildThings floral chandelier as a base, you can dress up your next venue with custom floral creations at a variety of heights for maximum impact. Exuberant blooms in jewel tones contrast perfectly against the natural setting at the chic outdoor wedding in photo #2 above. A series of uber upscale orchid floral chandeliers is a gorgeous Decor element at the outdoor reception in Photo#3. Complemented by hanging raindrop glass candleholders above and a long, low floral runner on the table, these floral chandeliers take center stage without upstaging the centerpiece. Floral Chandeliers as Subtle Accents Sometimes, your already pretty space needs just a little je ne sais quoi. Except that we do sais quoi ~ floral chandeliers are a pretty, classic way to fill in ceremony and reception spaces with elegance that does not overwhelm. Floral swags and a floral chandelier in creams and pinks highlight the most important moment of the day without overwhelming the bride and groom, and they photograph perfectly. We love the floral chandeliers at staggered heights and how they add a pop of color and overall gorgeousness to any reception, and by hanging several of them low over table, you can maximize seating and conversation by eliminating the need for tabletop centerpieces. Making florals do double duty in this way is a secret to maximizing your clients" budgets, and there"s no better way to prove that a professional event designer is worth every penny than to take good care of the dollars entrusted to you. In Photo #5 close-up of this hydrangea and rose floral chandelier shows just how doable this look is with our floral chandeliers as your base. Floral chandeliers are one of those quiet worker bee pieces that don't take the spotlight, but that make your design work shine by facilitating show-stopping arrangements, efficient event setup, and myriad design concepts, week in and week out. And, shameless plug, you can learn more about how to use floral chandeliers and other tools of the trade at Sarah Campbell"s upcoming workshops. She is the brains behind Intrigue Designs, one of the best event firms in the industry ~ always innovating and always sharing knowledge. Check out Sarah"s teaching schedule here, and don't wait too longÉ Her workshops sell out on the regular. Intrigue Teaches Workshops Here Whether you need to build a top flight design warehouse, or to finish out your existing stock with a few key pieces, let us help you find the innovative Decor must that will make you money immediately. Our customer service folks are the nicest in the industry, and they're ready to help you place an order that will take your designs to the next level. Give us a call at 1-928-855-6075 and let us help you find the reusable, sustainable Decor products that will bring top shelf design within reach with premium quality, easy setup, breakdown, and storage, and ultimate design flexibility. We look forward to seeing how you use our pieces to make your clients" dreams come true. The items used in some of these photos were: Hayden Candle Chandelier Lulu Candle Chandelier Hanging Glass Teardrops Rachelle Candle Chandelier Floral Chandeliers ]]>wild-pagerewophonmtv11https://s.yimg.com/aah/shopwildthings/floral-canopy-customize-your-event-venue-using-faux-florals-14.jpghttps://s.yimg.com/aah/shopwildthings/floral-canopy-customize-your-event-venue-using-faux-florals-15.jpgCreate a Floral Wonderland Wedding Ceremony with Faux Blooms and a Statement Chandelier When the sky is the limit of your design creativity and a floral wonderland is your goal, take a page from this stunning playbook and wrap your ceremony in a bell jar of realistic faux florals. Wondering how to get this seemingly natural look within the limits of your venues? Let us introduce you to some of the hottest products to hit the event industry and show you how to put them into action at your next event. They are ready and waiting to ship from our huge warehouse of in stock products to become a blank canvas for your faux (or real) floral magic. If your venue offers infrastructure that can support a suspended floral chandelier, we bring you two easy to install options that will sell over and over again. Option 1 is the Mac Daddy version, six feet in diameter and fabulous in every way. Our floral chandelier frame has two tiers of metal and can support live or faux florals, suspended floral garlands, string curtains, candle holders, crystals… You get the idea. This is the Sampson of floral chandeliers, and he is ready to put that muscle to work at your next season of events.
6' Floral Chandelier Frame
Hanging Floral Garlands
Artificial Greenery
Multi-Arm Chandeliers
String Curtains
Light Curtains & Event Lighting Along the same lines but scaled back a tad, Option 2 is the JV version of a floral chandelier, about four feet in diameter and ready to support a single tier of faux florals along with a few well chosen suspended pieces.
4' Floral Chandelier Frame
Bouquets, Sprays & Garlands
Green Walls & Draping Sprays
Tiered Chandeliers
Event Lighting Finally, when your venue has nothing that you can use as a base for suspended florals, we suggest starting with Option 3: a chuppah gazebo structure. You can add faux florals and string curtains or suspended garlands and create a similar effect with absolutely no venue infrastructure. When you can make her dreams appear out of thin air, you’ll be a hero in the eyes of your client, who wants the enclosed floral wonderland without the details about venue infrastructure. Check out the Option 3 Links below for products to create this look out of thin air and open space.
Chuppah Gazebos & Arches
Bendable Stem Floral Garlands
Pomander Kissing Flower Balls
Sheer Draping Panels
Hanging Candle Holders
Beaded Crystal Garlands Love the image but don’t see quite the perfect option in our ready to use stock described above? Luckily, there’s an Option 4 that is in many ways the best of the best, with no compromises. We have the ability to custom fabricate any product that you need to get the effect that your client requires, and we do it all.the.time for huge names in the event design business. We love a challenge, and we think of ourselves like design therapists ~ give us a call, pour out your problems, help us understand exactly what’s missing in your design life, and we’ll create a solution that addresses the challenges you face. Better yet, we’ll do it on budget, on time, and with quality that you didn’t know still existed in our industry. Whether you need in stock products to create Options 1, 2, or 3, or you need an innovative and original custom solution, give the nicest customer service folks in the event business a call at 1-928-855-6075. We’re waiting to help you build the dream team of event décor products to serve your clients and your bottom line.]]>wild-pagegiant-oversized-silk-flowers11https://s.yimg.com/aah/shopwildthings/floral-centerpiece-riser-kit-adjustable-pick-colors-crystals-71.jpghttps://s.yimg.com/aah/shopwildthings/floral-centerpiece-riser-kit-adjustable-pick-colors-crystals-72.jpgFuller on Top Picture on Right: We used all of the strands to hang around the frame of the White Upsy Daisy Stand. We cut the garlands in half and wire tied them to the top of the frame. We then used some of the leftover pieces to wrap the top of the frame to hide it. We also added some of our High Quality Acrylic Garland Strands to add some glitz, but those are optional and do not come with this kit. We only needed about 10 feet of Acrylic Garland to make an impact on this piece, and most of our Garlands come in bags that are 30 feet long each! Cover the Base: Picture on Left: Simply use less strands up top and save about 1/2 of one garland to hide wrap the base! The Upsy Daisy White Centerpiece Riser is a Staple for most of our Event Planners. It is affordable, attractive, and able to be reused in a bunch of different designs! We also offer it in a CHROME color. Included in your Kit: 3 Pcs Floral Garlands 2 Flower Styles available in 4 different colors each. Select your color from the Swatch Charts and then use the drop-down menu that says "Choose Flower" 1 Pc of your choice: - White Upsy Daisy Floral Riser (34-60" Tall) - Chrome Riser (22-60" Tall) - add $20.00 for Chrome Please use the drop-down menu that says Choose Riser to select which color riser you'd like. The floral style used in the Main Image is Floral Style #1 Fuchsia on the White Upsy Daisy Riser. The images below show these same Flower Styles made into large chandeliers. We can do this for you as well - but these are intended to show you what these flowers look like a little better than the color swatches. Flower Style #2 in Orchid Pink (Shown hanging with our High Quality Acrylic Garlands.) Flower Style #2 in Ivory (Shown hanging with our High Quality Acrylic Garlands.) Flower Style #2 in Purple (Shown hanging with our High Quality Acrylic Garlands.) ]]>wild-pagesilk-flower-garlands11https://s.yimg.com/aah/shopwildthings/floral-chandelier-crystals-8-flower-choices-easy-diy-kit-21.jpghttps://s.yimg.com/aah/shopwildthings/floral-chandelier-crystals-8-flower-choices-easy-diy-kit-22.jpgAnticipate assembly to take no more than 30 minutes for your first Kit, and it will go faster after you play with one a bit. We will send detailed instructions with your Kit. The author here (Katie) can barely tie her shoes, and she's got these down to a science and can assemble them in about 15 minutes flat! Purchased separately, the total of the items in this kit would be from $141.99 to $149.99, depending on the floral garland chosen! Hang them over tables, at the top of tents, and more. Anywhere that you need glamour and color can benefit from this fabulous Floral Chandelier! Scroll down to see large images of the 2 Flower Choices and 8 Colors Available! The image showing the purple chandelier gives one example of how this kit can be configured. Want longer or alternating strands of florals? Cut the garlands at different lengths. Want more crystals or no crystals? Just buy another bag, if you'd like. The frame for this chandelier is 24" in diameter. There are 2 tiers, so you can hang the garlands on both levels and have a fabulous depth effect. The Floral Chandelier that we made is 2 Feet Wide x 4 Feet Long. We'll include the instructions to make the exact Floral Chandelier that you see in the main image with the Purple Chandelier. Included in your kit: 6 Super-Premium Floral Garlands - you will cut these to make strands (We personally hand select these garlands for their quality and beauty. Our stringent quality standards are adhered to by all of our factories. There is "ShopWildThings Quality" and then "Standard Quality". We pay more because of our requirements, because we'd rather that you jump out of your skin with joy over our products.) 1 Wire Frame with already attached sturdy Easy-Wires for VERY quick attachments 1 Bag of High Quality Acrylic Crystal Garlands, 30 Feet Long (read above about our quality. Same goes for our Crystals as our Flower Garlands) 1 Hanging Chain Kit (assembled, just add to frame) 1 Instruction Sheet for Quick Assembly Please make your selection of Flower Style & Color by using the Photo Swatches showing Flower Style 1 and Flower Style 2. Flower Style #2 in Orchid Pink Flower Style #2 in Ivory Flower Style #1 in Purple ]]>wild-pagesilk-flower-garlands11https://s.yimg.com/aah/shopwildthings/orchid-floral-chandelier-with-crystal-strands-over-5-1-2-feet-long-choose-flower-color-87.jpghttps://s.yimg.com/aah/shopwildthings/orchid-floral-chandelier-with-crystal-strands-over-5-1-2-feet-long-choose-flower-color-88.jpg Custom Orders: Give us a call if you need a completely different flower, color, a mix of colors, a different style of Crystal Bead, or a different size - be it a different frame, a multi-tiered frame, or even a Floral Chandelier in sizes up to 6 Feet in Diameter! Want a Square Floral Chandelier? We do that too! Our in-house fabrication studio employs a host of American Workers who do the MOST amazing high-quality designs! This Floral Chandelier is made-to-order. Please allow 10 business days prior to shipping. If your order is needed sooner, please enter notes into the comments section of your order. ]]>wild-pagecurtains-and-columns1floral-chandelierwhite-flower-chandelier-wedding-decorfloral-chandelier-event-kitflower-chandeler-column-kitcrystal-hanging-column-beaded-strands-large-event-decorsilkflowersbecrcohangingcandlefloral-walls-greenery-backdropsartificialgreeneryropokibagaandstropesiropebsfloral-centerpiece-kitsilk-flower-garlandsgiant-oversized-silk-flowers1https://s.yimg.com/aah/shopwildthings/hanging-floral-chandeliers-columns-82.jpghttps://s.yimg.com/aah/shopwildthings/hanging-floral-chandeliers-columns-83.jpgFloral Chandeliers are ALL THE RAGE right now and from small venues to large, inside or out, top event planners are creating the most awesome floral displays that make our jaws drop! So, we've gathered together everything you need to make your vision a reality! From fluffy flower sprays and garlands to full and lush greenery vines and even crystal strands, we've stocked every color and style to please even the most discerning planner. And, don't forget the hardware! We have adjustable risers, hanging frames, arches and pipe and drape sets. If florals aren't your cup of tea, let us help. We can make ANY size Floral Chandelier for you CUSTOM. Choose from any of our dozens of floral garlands, let us know your colors, if you would like crystals added, what size you need...and we'll take care of the rest! Call us with your needs and ideas: 928-855-6075. Our in-house studio books up quickly, call today!wild-pagerewophonmtv11https://s.yimg.com/aah/shopwildthings/floral-chandeliers-from-top-shelf-trend-to-timelessness-32.jpghttps://s.yimg.com/aah/shopwildthings/floral-chandeliers-from-top-shelf-trend-to-timelessness-33.jpgFloral Chandeliers Speak Luxury Over Your Wedding
When they first appeared on the wedding and event scene a few years ago, floral chandeliers were a hot trend that cutting edge professional event designers were using to set their events apart from the pack. Fast-forward a few years, and they’re almost expected at the most fabulous weddings and events. Now, the most admired designers are refining their techniques and expanding their repertoires to continue to use floral chandeliers in innovative, jaw-dropping installations at a variety of price points and aesthetics. Let us take you inside a floral chandelier to see the components that make these gorgeous behemoths possible. In the main photo, this monochromatic floral chandelier plays with texture by including a variety of types of flowers, creating an overall shape that evokes peonies by using different Suspended Florals. A quick look inside the structure of the chandelier reveals the two tier aluminum display frame that makes floral chandelier installation infinitely easier, and our faux florals put this sort of wow! feature in reach of many budgets. If your bride can afford live florals and your crew can handle the setup, of course the effect is nothing short of breathtaking, and our Aluminum Frame is the perfect starting point. And if you’re looking for a great place to trim expenses to meet your brides’ budgets, adding a faux floral setup like this one to your arsenal is a proposition with great ROI. Suspended Floral Centerpieces or Personal Floral Chandeliers? Either Way, They’re A Showstopper
In the 2nd photo, what could be more decadent than outdoor tables with their own floral chandeliers? This sumptuous waterfront wedding sets a new bar for elegance with Cascading Orchids floating above a long, low centerpiece of roses and tropical florals. If your budget – and the climate and weather conditions – allow live blooms to give you the look and the bottom line that you want, we support you 100%. But if windy oceanfront weather and/or your inner frugal warrior lead you to consider faux florals, our selection of Huge Individual Blooms, cascading suspended florals, and super reliable, well built risers might just be the solution. As a designer, you can sell this basic setup customized with color, flower styles (our risers work equally well with real and faux options, btw), candles, and anything else that your brides desire. Wondering exactly what is “next level” when your bride starts at fabulous? As in the 3rd photo, a room-sized floral chandelier coordinated with low tabletop centerpieces must be on the short list for a stratospheric level of bridal game. In this over the top luxury wedding by I Am Flower, we just cannot get enough of the variegated, low hanging floral chandelier combined with large floral centerpieces on Crystal Risers and supersized crystal candelabras. Truly, this is luxury at its finest ~ and most decadent. Capitalize on Your Venue’s Existing Structures by Accenting Them with Faux Floral Chandeliers
When your venue has great bones ~ and a yummy rustic shelter like the one in the 4th photo ~ suspended faux florals in a bold color are such an easy way to create a floral chandelier. We love the icicle effect of the pink florals combined with the Sparkling Crystal Candelabras and mercury glass votives on the tabletop. Literally, your only additional expense will be replacing the candles, and you can sell this setup to bride after bride for years to come. We pride ourselves on spotting the trends that have style and staying power. For professional event designers with a long-term business vision, we supply the best quality in both the sexy showstopper event décor items, and in the unsung hero project helping tools that keep those show ponies looking great at event after event. Whether you’re just now able to invest in the building blocks for your first floral chandelier or suspended centerpiece, or you’re ready to take your setups to the next level, we are your go to source for information, quality products, and friendly customer service. So give the nicest customer service folks in the event business a call at 1-928-855-6075, and let us help you offer your brides the looks that they want at prices that will provide top shelf value on top flight looks.]]>wild-pageexlocu1https://s.yimg.com/aah/shopwildthings/floral-display-stand-and-riser-silver-chrome-28-5-high-66.jpghttps://s.yimg.com/aah/shopwildthings/floral-display-stand-and-riser-silver-chrome-28-5-high-67.jpgThis centerpiece or floor standing flower pot is awesome! The chrome is shiny and reflective and will pick up on the tiniest amount of light in the room. The overall height is 29", the base is 6.5" in diameter and bowl is 8" in diameter and 3.5" deep. Make a centerpiece or floor display using a submersible LED Floralyte mixed with some colorful strands of gems and crystal sprays! Quick - easy - beautiful!wild-pagewhclde11https://s.yimg.com/aah/shopwildthings/floral-display-stands-victory-white-set-of-4-19-1-2-w-x-40-49-60-71-1-2-h-26.jpghttps://s.yimg.com/aah/shopwildthings/floral-display-stands-victory-white-set-of-4-19-1-2-w-x-40-49-60-71-1-2-h-27.jpgOversized Silk, Foam or Paper Flower Heads and fill in with leafy sprays, ivy or Baby's Breath Bouquets. For a daintier look, we have a huge selection of silk florals in an array of colors and styles. From dangling sprays and garlands to Flowering Tree Branches, the bendable stems easily fit into the grids of the frame. Curtain hooks are great for dangling crystal pendants and with a frame chocked full of flowers, they'll easily be concealed. If you prefer using pre-made flower walls or green wall mats, you'll just need to do a bit of measuring to determine the amount of walls you'll need. Coverage will vary depending on the mats you choose and please remember that all of our flower and greenery mats can easily be cut to fit the frame. Here's an example using a 10 1/2" Square Boxwood Mat: the smallest frame would need 8 mats and the largest would need 14. Say you're using an average sized flower wall like this 19" x 25 1/2" Rose & Hydrangea Mat, the small frame would need 1 1/2 mats and the large frame would need 3 mats. Using a boxwood background with flowers on top is an elegant and colorful combination and since all of our mats are attached to a plastic grid framework, simple poke the flower stem through the boxwood and attach to the back of the frame. Weave flower garlands, tulle, beaded crystal strands, string lights or butterfly garlands through the grids. For weddings and events, parties and celebrations, for hotel lobbies or for unique store displays, "Victory" will be yours with this set of 4, metal display stands! If you're not using the legs, please subtract 3/4" from the height stated above.]]>wild-pagediycraftflfashmego10flfashmesi10flfashwh10yaflfashir10yaflfashgrgr10flfashliblflfashmebl10flfashyeflfashmecepflfashcep10yflfashorflfashredflfashmeredflfashblflfashsaflfashbrflfashmetuflfashmpusequinfabricdiycraftflfasecoavartificialgreeneryfloral-walls-greenery-backdrops1https://s.yimg.com/aah/shopwildthings/floral-fabric-sheeting-19-colors-available-117.jpghttps://s.yimg.com/aah/shopwildthings/floral-fabric-sheeting-19-colors-available-118.jpgPlease see the short video at the bottom of this page for further information on this fantastic product! Cover tables. Cover walls. Decorate a parade float. Staple it to a wall. Hang it in a window. Cover a ceiling. Use it in a display window and place product on it. This stuff is amazing, and a hot new trend in event decor. Used together with our beaded curtains, chandeliers, diamond confetti and chair ties, you will be able to create a spectacular event or display. Floral Fabric Sheeting is fire rated. Just let us know if you are decorating a venue that requires a specification sheet to meet fire code requirements. Simply apply it like wrapping paper to props and boxes. Hang it using double-sided tape to walls and banner stands. Unlike fabrics, you will never have to hem it or worry about a frayed edge. Ready to install right out of the box! Click on the colors below to order. Because of frequent damage in return shipping, we regret that this item is not returnable]]>wild-pagerewophonmtv11https://s.yimg.com/aah/shopwildthings/floral-fabric-sheeting-creative-decorating-ideas-26.jpghttps://s.yimg.com/aah/shopwildthings/floral-fabric-sheeting-creative-decorating-ideas-27.jpg]]>wild-pageflfadefa11https://s.yimg.com/aah/shopwildthings/floral-fabric-sheeting-black-45.jpghttps://s.yimg.com/aah/shopwildthings/floral-fabric-sheeting-black-46.jpgBecause of frequent damage in return shipping, we regret that this item is not returnable ]]>wild-pageflfadefa11https://s.yimg.com/aah/shopwildthings/floral-fabric-sheeting-brown-42.jpghttps://s.yimg.com/aah/shopwildthings/floral-fabric-sheeting-brown-43.jpgBecause of frequent damage in return shipping, we regret that this item is not returnable ]]>wild-pageflfadefa11https://s.yimg.com/aah/shopwildthings/floral-fabric-sheeting-grass-green-45.jpghttps://s.yimg.com/aah/shopwildthings/floral-fabric-sheeting-grass-green-46.jpgBecause of frequent damage in return shipping, we regret that this item is not returnable ]]>wild-pageflfadefa11https://s.yimg.com/aah/shopwildthings/floral-fabric-sheeting-iridescent-35.jpghttps://s.yimg.com/aah/shopwildthings/floral-fabric-sheeting-iridescent-36.jpgBecause of frequent damage in return shipping, we regret that this item is not returnable ]]>wild-pageflfadefa11https://s.yimg.com/aah/shopwildthings/floral-fabric-sheeting-light-blue-46.jpghttps://s.yimg.com/aah/shopwildthings/floral-fabric-sheeting-light-blue-47.jpgBecause of frequent damage in return shipping, we regret that this item is not returnable ]]>wild-pageflfadefa11https://s.yimg.com/aah/shopwildthings/floral-fabric-sheeting-medium-blue-46.jpghttps://s.yimg.com/aah/shopwildthings/floral-fabric-sheeting-medium-blue-47.jpgBecause of frequent damage in return shipping, we regret that this item is not returnable ]]>wild-pageflfadefa11https://s.yimg.com/aah/shopwildthings/floral-fabric-sheeting-metallic-cerise-pink-46.jpghttps://s.yimg.com/aah/shopwildthings/floral-fabric-sheeting-metallic-cerise-pink-47.jpgBecause of frequent damage in return shipping, we regret that this item is not returnable ]]>wild-pageflfadefa11https://s.yimg.com/aah/shopwildthings/floral-fabric-sheeting-metallic-gold-50.jpghttps://s.yimg.com/aah/shopwildthings/floral-fabric-sheeting-metallic-gold-51.jpgBecause of frequent damage in return shipping, we regret that this item is not returnable ]]>wild-pageflfadefa11https://s.yimg.com/aah/shopwildthings/floral-fabric-sheeting-metallic-purple-45.jpghttps://s.yimg.com/aah/shopwildthings/floral-fabric-sheeting-metallic-purple-46.jpgBecause of frequent damage in return shipping, we regret that this item is not returnable ]]>wild-pageflfadefa11https://s.yimg.com/aah/shopwildthings/floral-fabric-sheeting-metallic-red-42.jpghttps://s.yimg.com/aah/shopwildthings/floral-fabric-sheeting-metallic-red-43.jpgBecause of frequent damage in return shipping, we regret that this item is not returnable ]]>wild-pageflfadefa11https://s.yimg.com/aah/shopwildthings/floral-fabric-sheeting-metallic-silver-61.jpghttps://s.yimg.com/aah/shopwildthings/floral-fabric-sheeting-metallic-silver-62.jpgBecause of frequent damage in return shipping, we regret that this item is not returnable ]]>wild-pageflfadefa11https://s.yimg.com/aah/shopwildthings/floral-fabric-sheeting-metallic-turquoise-43.jpghttps://s.yimg.com/aah/shopwildthings/floral-fabric-sheeting-metallic-turquoise-44.jpgBecause of frequent damage in return shipping, we regret that this item is not returnable ]]>wild-pageflfadefa11https://s.yimg.com/aah/shopwildthings/floral-fabric-sheeting-orange-45.jpghttps://s.yimg.com/aah/shopwildthings/floral-fabric-sheeting-orange-46.jpgBecause of frequent damage in return shipping, we regret that this item is not returnable ]]>wild-pageflfadefa11https://s.yimg.com/aah/shopwildthings/floral-fabric-sheeting-pink-transformers-3-46.jpghttps://s.yimg.com/aah/shopwildthings/floral-fabric-sheeting-pink-transformers-3-47.jpgBecause of frequent damage in return shipping, we regret that this item is not returnable ]]>wild-pageflfadefa11https://s.yimg.com/aah/shopwildthings/floral-fabric-sheeting-red-45.jpghttps://s.yimg.com/aah/shopwildthings/floral-fabric-sheeting-red-46.jpgBecause of frequent damage in return shipping, we regret that this item is not returnable ]]>wild-pageflfadefa11https://s.yimg.com/aah/shopwildthings/floral-fabric-sheeting-sand-42.jpghttps://s.yimg.com/aah/shopwildthings/floral-fabric-sheeting-sand-43.jpgBecause of frequent damage in return shipping, we regret that this item is not returnable ]]>wild-pageflfadefa11https://s.yimg.com/aah/shopwildthings/floral-fabric-sheeting-white-45.jpghttps://s.yimg.com/aah/shopwildthings/floral-fabric-sheeting-white-46.jpgBecause of frequent damage in return shipping, we regret that this item is not returnable ]]>wild-pageflfadefa11https://s.yimg.com/aah/shopwildthings/floral-fabric-sheeting-yellow-45.jpghttps://s.yimg.com/aah/shopwildthings/floral-fabric-sheeting-yellow-46.jpgBecause of frequent damage in return shipping, we regret that this item is not returnable ]]>wild-pageledupwawavaeiffel-light-strand-warm-white-6pcseiffel-light-strand-white-6pcseiffel-light-strand-blue-6pcseiffel-light-strand-violet-6pcseiffel-lights-silver-wire-20-leds-warmwhite-crbatthanging-floral-light-warm-white-10pcshanging-floral-light-white-10pcsfliiorledliwfliiamyeledlfliigrledliwfliiteledliwfliirledliwifliipiledliwflgrledli1tiflteledli1tiflamledli1tivaflvaeitocysubmersibleledshallleditponpaacledreledorbsledlidiupvaostlinewarm-white-led-saucerledlipucowirled-vase-light-6inch-round-rgb-with-remote6-inch-light-base-color-changing-with-remoteled-vase-light-6inch-round-warm-whiteled-vase-light-6inch-round-pure-whiteled-centerpiece-vase-light-with-remote-4inch-rgb3-inch-vase-light-base-rgb-with-remote-waterproofblackbaseledlight6inchrgblyteringrgb28eil8ledlidibeil6ledlidibledvaselightse4lubaopunliwaterproof-led-vase-light-with-remote-whitelyteringwhite6inchled-vase-light-round-4inch-warm-whiteled-vase-light-round-4inch-whitelargesubmersibleledlightemaxi32rgbwhitebaseledlightrgbledupwawavaoaflsulodesyledicecubaopflledcabaoplightingledvaselightlargeled-vase-light-square-battery-operated20057triple-led-submersible-domed-rgb20062double-led-submersible-warm-whitedouble-led-submersible-cool-whitesubrdobufliisubmersibleledcoolwhitesingle-led-submersible-warm-whitesingle-led-submersible-cool-whitesingle-led-submersible-ambersingle-led-submersible-redsingle-led-submersible-pinksingle-led-submersible-purplesingle-led-submersible-bluesingle-led-submersible-tealsuflwhledli1suflgrledli1suflteledli1suflpiledli1suflorledli1suflrgbredgr200502005120052200532005420055fiber-optic-party-lights-with-clip-14inches1https://s.yimg.com/aah/shopwildthings/led-floralyte-ii-multiple-use-lights-many-colors-48.jpghttps://s.yimg.com/aah/shopwildthings/led-floralyte-ii-multiple-use-lights-many-colors-49.jpgLet our Floralyte II LED lights from ShopWildThings create razzle-dazzle lighting effects at your special event. Light up stage props. Create breathtaking light effects for centerpieces, ice sculptures, flower arrangements or posh party tables set with our elegant LED candles. Hang these Floralyte II saucers, or drop them into vases. These versatile little lights are each 1 1/2 inches long, 3/4 of an inch wide and about 1/4-inch thick. Our New DazzLED Line of Event Lighting is exclusively made for ShopWildThings! Each light has an on/off switch. Our Floralyte II LED bulbs are available in sets of 10. Choose red, orange, amber/yellow, blue, green, white, teal, purple or pink. We also carry bulbs that change colors from red to green to blue. Browse our photographs that showcase these dazzling little lights in use inside centerpieces, as flower vase Decorations or as set Decor .wild-pageoaflsulodesy1https://s.yimg.com/aah/shopwildthings/floral-chandelier-centerpiece-riser-48-white-metal-57.jpghttps://s.yimg.com/aah/shopwildthings/floral-chandelier-centerpiece-riser-48-white-metal-58.jpgGarlands and Greenery to create a two-level floral extravaganza! This is also wonderful for holding our Pomander Rose and Hydrangea Balls! The design of the basket is ideal not only for holding a multitude of florals, garlands, greenery and Pomander Kissing Balls but consider using it as a riser for large, flameless pillar candles (minimum 5 1/2" in diameter) or to create an elevated table chandelier. If you like sparkle like we like sparkle then you'll love the framework of the basket as it can easily be used to dangle tons of sparkling crystal beads! As a floor riser, a Crystal Beaded Chandelier like Avalon or Ashlynn with a 6 1/4" inner ring sits perfectly atop the basket with plenty of room for an LED light saucer if you'd like to downlight the chandelier. Dress the bottom with flower garlands and greenery for a knockout floral chandelier accent piece! Easy to store and transport, this riser weighs 2 lbs. and can be stored in a space measuring 24" x 4" x 12.5".]]>wild-pagewhclde1https://s.yimg.com/aah/shopwildthings/flower-ball-14-premium-silk-roses-peonies-hydrangeas-cream-35.jpghttps://s.yimg.com/aah/shopwildthings/flower-ball-14-premium-silk-roses-peonies-hydrangeas-cream-36.jpgWe expect this item to come Back in Stock shortly. Often we have a comparable product that we can quickly help you find, so please give us a call at 928.855.6075. If you'd prefer this item only, please enter your email address in the box where it says "Notify me when this item is back in stock!" and as soon as this item is made orderable on our site, you'll get an email from us!

Premium Silk Pomander Kissing Ball With Huge Roses, Peonies and Hydrangeas 13 3/4" Wide Cream Flower Ball Splits into 2 Halves With this 1 flower ball, you really get 2 toppers for vases or risers! In the main photo, the leftmost shot shows the whole flower ball on a vase while the upper right shows half of the ball sitting on a vase. The bottom right shows the ball split into 2 halves. So very elegant and so very full, our Cream Flower Ball is 13 3/4" in diameter and bursting with lovely silk flowers that are huge and luscious! Each ball splits into 2 halves so you can use this Pomander Kissing Ball in a variety of ways. There are 37 huge blooms consisting of 18 roses that measure 4" wide by 3" tall and 19 peonies that measure 3 1/2" wide by 3" tall! The remainder of the ball is filled with 2 1/2" wide hydrangeas and the variety and size of flowers makes this ball visually and texturally outstanding! There are green silk leaves popping from the base of the flowers and with a little fluffing, you cannot see the plastic grid frame at all. This is one grandiose item that splits into 2 superior products! At just under 14", this flower ball is pretty substantial and makes jaw-dropping wedding and event Decor. For maximum impact centerpiece Decor, place an entire ball atop a tall Mermaid Vase or split the ball into 2 halves to gain twice the decorating capacity. There are pegs and holes on the frame so you can split and reconnect the halves as much as needed. Each half sphere can sit on a Crystal Beaded Centerpiece Riser, elevated cake stand or use to outline the cake table. These half balls can also be attached to flower walls or stapled to actual walls. For outdoor ceremonies, hang from trees, tents and arches or create a romantic aisle walkway by placing on tall Floral Risers. For hanging, the plastic grid framework makes it easy to attach a ribbon or if you'd like to make them a bit more ritzy, attach Ivory Pearl or Sparkling Crystal Garland Strands. These floral accent balls are so easy to work with and give a huge visual impact. We offer our Flower Pomander Kissing Balls in many sizes, colors and styles so you're sure to find the perfect flowers to fit your occasion! We shopped and shopped trying to find quality flower balls that are jam-packed with blooms that look like real flowers, without the expense of fresh flowers. We feel that the superiority and style of these decorative accent pieces will meet the needs of discerning buyers with a cost that won't break the bank!]]>wild-pagelimegreendecor1https://s.yimg.com/aah/shopwildthings/flower-ball-silk-hydrangea-pomander-kissing-ball-10-aqua-34.jpghttps://s.yimg.com/aah/shopwildthings/flower-ball-silk-hydrangea-pomander-kissing-ball-10-aqua-35.jpg
Create incredible wedding and event centerpiece designs without having to fuss and stress over messing with real flowers and the shocking cost of real flowers. These are ideal for flower girls to carry down the aisle and you can also line your aisle by hanging these from shepherds' hooks. For centerpieces, you can hang them from manzanita trees, place them on a vase or simply lay on a table. They are also great for adding lots of color and volume to wedding arches. The inside frame is plastic so it's very easy to string the balls together to form a garland and you can dress them up by adding strands of beads or crystal pendants.

With the wide variety of colors and sizes, it's easy to match any color scheme or party theme with these marvelous, colorful blooms of nature!]]>wild-pagebltude1https://s.yimg.com/aah/shopwildthings/flower-ball-silk-hydrangea-pomander-kissing-ball-10-blue-98.jpghttps://s.yimg.com/aah/shopwildthings/flower-ball-silk-hydrangea-pomander-kissing-ball-10-blue-99.jpg
Create incredible wedding and event centerpiece designs without having to fuss and stress over messing with real flowers and the shocking cost of real flowers. These are ideal for flower girls to carry down the aisle and you can also line your aisle by hanging these from shepherds' hooks. For centerpieces, you can hang them from manzanita trees, place them on a vase or simply lay on a table. They are also great for adding lots of color and volume to wedding arches. The inside frame is plastic so it's very easy to string the balls together to form a garland and you can dress them up by adding strands of beads or crystal pendants.

With the wide variety of colors and sizes, it's easy to match any color scheme or party theme with these marvelous, colorful blooms of nature!]]>wild-pagebltude1https://s.yimg.com/aah/shopwildthings/flower-ball-silk-hydrangea-pomander-kissing-ball-10-royal-blue-52.jpghttps://s.yimg.com/aah/shopwildthings/flower-ball-silk-hydrangea-pomander-kissing-ball-10-royal-blue-53.jpg
Create incredible wedding and event centerpiece designs without having to fuss and stress over messing with real flowers and the shocking cost of real flowers. These are ideal for flower girls to carry down the aisle and you can also line your aisle by hanging these from shepherds' hooks. For centerpieces, you can hang them from manzanita trees, place them on a vase or simply lay on a table. They are also great for adding lots of color and volume to wedding arches. The inside frame is plastic so it's very easy to string the balls together to form a garland and you can dress them up by adding strands of beads or crystal pendants.

With the wide variety of colors and sizes, it's easy to match any color scheme or party theme with these marvelous, colorful blooms of nature!]]>wild-pagepinks1https://s.yimg.com/aah/shopwildthings/flower-ball-silk-hydrangea-pomander-kissing-ball-10-pink-29.jpghttps://s.yimg.com/aah/shopwildthings/flower-ball-silk-hydrangea-pomander-kissing-ball-10-pink-30.jpgCenterpiece Vase. For table Decor or floor accent pieces, place atop a Floral Riser. These are ideal for flower girls to carry down the aisle and you can also line your aisle by hanging these from Shepherds' Hooks. They are also great for adding lots of color and volume to wedding arches and the interior framework makes it easy to attach glitzy crystal garland strands or crystal pendants. Handy, practical, versatile with no mess or hassle! What a great element to have close at hand for those last minute emergencies when you need to create a stylish focal piece, and of course these kissing balls can be used over and over!]]>wild-pagereddecor1https://s.yimg.com/aah/shopwildthings/flower-ball-silk-hydrangea-pomander-kissing-ball-10-red-69.jpghttps://s.yimg.com/aah/shopwildthings/flower-ball-silk-hydrangea-pomander-kissing-ball-10-red-70.jpgCenterpiece Vase. For table Decor or floor accent pieces, place atop a Floral Riser. These are ideal for flower girls to carry down the aisle and you can also line your aisle by hanging these from Shepherds' Hooks. They are also great for adding lots of color and volume to wedding arches and the interior framework makes it easy to attach glitzy crystal garland strands or crystal pendants. Handy, practical, versatile with no mess or hassle! What a great element to have close at hand for those last minute emergencies when you need to create a stylish focal piece, and of course these kissing balls can be used over and over!]]>wild-pagebltude1https://s.yimg.com/aah/shopwildthings/flower-ball-silk-hydrangea-pomander-kissing-ball-10-blue-100.jpghttps://s.yimg.com/aah/shopwildthings/flower-ball-silk-hydrangea-pomander-kissing-ball-10-blue-101.jpg
Create incredible wedding and event centerpiece designs without having to fuss and stress over messing with real flowers and the shocking cost of real flowers. These are ideal for flower girls to carry down the aisle and you can also line your aisle by hanging these from shepherds' hooks. For centerpieces, you can hang them from manzanita trees, place them on a vase or simply lay on a table. They are also great for adding lots of color and volume to wedding arches. The inside frame is plastic so it's very easy to string the balls together to form a garland and you can dress them up by adding strands of beads or crystal pendants.

With the wide variety of colors and sizes, it's easy to match any color scheme or party theme with these marvelous, colorful blooms of nature!]]>wild-pagepinks1https://s.yimg.com/aah/shopwildthings/flower-ball-silk-hydrangea-pomander-kissing-ball-12-pink-26.jpghttps://s.yimg.com/aah/shopwildthings/flower-ball-silk-hydrangea-pomander-kissing-ball-12-pink-27.jpgTall Centerpiece Vase. To accentuate an aisle or for a floor accent piece, place atop a Floral Riser. These are ideal for flower girls to carry down the aisle and you can also line your aisle by hanging these from Shepherds' Hooks. They are also great for adding lots of color and volume to wedding arches and the interior framework makes it easy to attach glitzy crystal garland strands or crystal pendants. Handy, practical, versatile with no mess or hassle! What a great element to have close at hand for those last minute emergencies when you need to create a stylish focal piece, and of course these kissing balls can be used over and over!]]>wild-pagepinks1https://s.yimg.com/aah/shopwildthings/flower-ball-silk-hydrangea-pomander-kissing-ball-6-fuchsia-42.jpghttps://s.yimg.com/aah/shopwildthings/flower-ball-silk-hydrangea-pomander-kissing-ball-6-fuchsia-43.jpg
With the wide variety of colors and sizes, it's easy to match any color scheme or party theme with these marvelous, colorful blooms of nature!]]>wild-pagewhclde1https://s.yimg.com/aah/shopwildthings/flower-ball-silk-hydrangea-pomander-kissing-ball-6-ivory-36.jpghttps://s.yimg.com/aah/shopwildthings/flower-ball-silk-hydrangea-pomander-kissing-ball-6-ivory-37.jpg
With the wide variety of colors and sizes, it's easy to match any color scheme or party theme with these marvelous, colorful blooms of nature!]]>wild-pagepinks1https://s.yimg.com/aah/shopwildthings/flower-ball-silk-hydrangea-pomander-kissing-ball-6-pink-36.jpghttps://s.yimg.com/aah/shopwildthings/flower-ball-silk-hydrangea-pomander-kissing-ball-6-pink-37.jpg
With the wide variety of colors and sizes, it's easy to match any color scheme or party theme with these marvelous, colorful blooms of nature!]]>wild-pagepinks1https://s.yimg.com/aah/shopwildthings/flower-ball-silk-hydrangea-pomander-kissing-ball-6-coral-24.jpghttps://s.yimg.com/aah/shopwildthings/flower-ball-silk-hydrangea-pomander-kissing-ball-6-coral-25.jpg
With the wide variety of colors and sizes, it's easy to match any color scheme or party theme with these marvelous, colorful blooms of nature!]]>wild-pagepurplestuff1https://s.yimg.com/aah/shopwildthings/flower-ball-silk-hydrangea-pomander-kissing-ball-6-purple-36.jpghttps://s.yimg.com/aah/shopwildthings/flower-ball-silk-hydrangea-pomander-kissing-ball-6-purple-37.jpg
With the wide variety of colors and sizes, it's easy to match any color scheme or party theme with these marvelous, colorful blooms of nature!]]>wild-pagereddecor1https://s.yimg.com/aah/shopwildthings/flower-ball-silk-hydrangea-pomander-kissing-ball-6-red-44.jpghttps://s.yimg.com/aah/shopwildthings/flower-ball-silk-hydrangea-pomander-kissing-ball-6-red-45.jpg
With the wide variety of colors and sizes, it's easy to match any color scheme or party theme with these marvelous, colorful blooms of nature!]]>wild-pagebltude1https://s.yimg.com/aah/shopwildthings/flower-ball-silk-hydrangea-pomander-kissing-ball-6-royal-blue-42.jpghttps://s.yimg.com/aah/shopwildthings/flower-ball-silk-hydrangea-pomander-kissing-ball-6-royal-blue-43.jpg
With the wide variety of colors and sizes, it's easy to match any color scheme or party theme with these marvelous, colorful blooms of nature!]]>wild-pagebltude1https://s.yimg.com/aah/shopwildthings/flower-ball-silk-hydrangea-pomander-kissing-ball-6-blue-58.jpghttps://s.yimg.com/aah/shopwildthings/flower-ball-silk-hydrangea-pomander-kissing-ball-6-blue-59.jpg
With the wide variety of colors and sizes, it's easy to match any color scheme or party theme with these marvelous, colorful blooms of nature!]]>wild-pagewhclde1https://s.yimg.com/aah/shopwildthings/flower-ball-silk-hydrangea-pomander-kissing-ball-6-white-35.jpghttps://s.yimg.com/aah/shopwildthings/flower-ball-silk-hydrangea-pomander-kissing-ball-6-white-36.jpg
With the wide variety of colors and sizes, it's easy to match any color scheme or party theme with these marvelous, colorful blooms of nature!]]>wild-pagewhclde1https://s.yimg.com/aah/shopwildthings/flower-ball-silk-hydrangea-pomander-kissing-ball-8-ivory-48.jpghttps://s.yimg.com/aah/shopwildthings/flower-ball-silk-hydrangea-pomander-kissing-ball-8-ivory-49.jpgSmaller Vase giving you twice the value! The interior plastic framework is pretty flexible so you can gently smoosh the edges and place inside the vase. For flower wall backdrops, use the separate halves to spell out a special message or design a monogram. Flower balls are so easy to use in centerpieces, adding a sophisticated touch of elegance for weddings and events. Place inside Cinderella carriages or Crown decorations for those specialty themed parties or top off a Tall Vase to create eye-catching table accent pieces. These are ideal for flower girls to carry down the aisle and you can also line your aisle by hanging these from Shepherds' Hooks. They are also great for adding lots of color and volume to wedding arches and the interior framework makes it easy to attach glitzy crystal garland strands or crystal pendants. Handy, practical, versatile with no mess or hassle! What a great element to have close at hand for those last minute emergencies when you need to create a stylish focal piece, and of course these kissing balls can be used over and over!]]>wild-pagepinks1https://s.yimg.com/aah/shopwildthings/flower-ball-silk-hydrangea-pomander-kissing-ball-8-pink-26.jpghttps://s.yimg.com/aah/shopwildthings/flower-ball-silk-hydrangea-pomander-kissing-ball-8-pink-27.jpgSmaller Vase giving you twice the value! The interior plastic framework is pretty flexible so you can gently smoosh the edges and place inside the vase. For flower wall backdrops, use the separate halves to spell out a special message or design a monogram. Flower balls are so easy to use in centerpieces, adding a sophisticated touch of elegance for weddings and events. Place inside Cinderella carriages or Crown decorations for those specialty themed parties or top off a Tall Vase to create eye-catching table accent pieces. These are ideal for flower girls to carry down the aisle and you can also line your aisle by hanging these from Shepherds' Hooks. They are also great for adding lots of color and volume to wedding arches and the interior framework makes it easy to attach glitzy crystal garland strands or crystal pendants. Handy, practical, versatile with no mess or hassle! What a great element to have close at hand for those last minute emergencies when you need to create a stylish focal piece, and of course these kissing balls can be used over and over!]]>wild-pagepinks1https://s.yimg.com/aah/shopwildthings/flower-ball-silk-hydrangea-pomander-kissing-ball-8-blush-pink-28.jpghttps://s.yimg.com/aah/shopwildthings/flower-ball-silk-hydrangea-pomander-kissing-ball-8-blush-pink-29.jpgSmaller Vase giving you twice the value! The interior plastic framework is pretty flexible so you can gently smoosh the edges and place inside the vase. For flower wall backdrops, use the separate halves to spell out a special message or design a monogram. Flower balls are so easy to use in centerpieces, adding a sophisticated touch of elegance for weddings and events. Place inside Cinderella carriages or Crown decorations for those specialty themed parties or top off a Tall Vase to create eye-catching table accent pieces. These are ideal for flower girls to carry down the aisle and you can also line your aisle by hanging these from Shepherds' Hooks. They are also great for adding lots of color and volume to wedding arches and the interior framework makes it easy to attach glitzy crystal garland strands or crystal pendants. Handy, practical, versatile with no mess or hassle! What a great element to have close at hand for those last minute emergencies when you need to create a stylish focal piece, and of course these kissing balls can be used over and over!]]>wild-pagereddecor1https://s.yimg.com/aah/shopwildthings/flower-ball-silk-hydrangea-pomander-kissing-ball-8-red-28.jpghttps://s.yimg.com/aah/shopwildthings/flower-ball-silk-hydrangea-pomander-kissing-ball-8-red-29.jpgSmaller Vase giving you twice the value! The interior plastic framework is pretty flexible so you can gently smoosh the edges and place inside the vase. For flower wall backdrops, use the separate halves to spell out a special message or design a monogram. Flower balls are so easy to use in centerpieces, adding a sophisticated touch of elegance for weddings and events. Place inside Cinderella carriages or Crown decorations for those specialty themed parties or top off a Tall Vase to create eye-catching table accent pieces. These are ideal for flower girls to carry down the aisle and you can also line your aisle by hanging these from Shepherds' Hooks. They are also great for adding lots of color and volume to wedding arches and the interior framework makes it easy to attach glitzy crystal garland strands or crystal pendants. Handy, practical, versatile with no mess or hassle! What a great element to have close at hand for those last minute emergencies when you need to create a stylish focal piece, and of course these kissing balls can be used over and over!]]>wild-pagewhclde1https://s.yimg.com/aah/shopwildthings/flower-ball-silk-rose-pomander-kissing-ball-10-5-ivory-56.jpghttps://s.yimg.com/aah/shopwildthings/flower-ball-silk-rose-pomander-kissing-ball-10-5-ivory-57.jpg
We offer our Flower Pomander Kissing Balls in 4 1/2", 6", 8 1/2" and 10 1/2" diameters. Try mixing the sizes and colors! The Roses are gloriously beautiful and full! We shopped and shopped trying to find Rose Balls that looked like real roses, didn't look cheap, but did not have the price tag of fresh flowers. We feel that this style will meet the needs of discerning buyers without a cost that will break the bank.]]>wild-pagewhclde1https://s.yimg.com/aah/shopwildthings/flower-ball-silk-rose-pomander-kissing-ball-10-5-white-56.jpghttps://s.yimg.com/aah/shopwildthings/flower-ball-silk-rose-pomander-kissing-ball-10-5-white-57.jpg
We offer our Flower Pomander Kissing Balls in 4 1/2", 6", 8 1/2" and 10 1/2" diameters. Try mixing the sizes and colors! The Roses are gloriously beautiful and full! We shopped and shopped trying to find Rose Balls that looked like real roses, didn't look cheap, but did not have the price tag of fresh flowers. We feel that this style will meet the needs of discerning buyers without a cost that will break the bank.]]>wild-pagewhclde1https://s.yimg.com/aah/shopwildthings/flower-ball-silk-rose-pomander-kissing-ball-4-5-ivory-55.jpghttps://s.yimg.com/aah/shopwildthings/flower-ball-silk-rose-pomander-kissing-ball-4-5-ivory-56.jpgOur Kissing Pomander Balls come in a huge variety of colors and are covered in high quality silk roses and are ready to be a key decorating element in your upcoming special day! Hang Pomanders from Shepherd's Hooks, from Manzanita Centerpiece Trees, or from Branches and Sprays in your floral Decor. Top a Vase with a Rose Ball and hang strands of our Crystals from them. Use the attached matching Satin Ribbon to hang them up if you'd like, or remove it and add a strand of pearls (we sell inexpensive Rolls of Pearls!) to hang them from. We think you could also really "fancy them up" by adding a short portion of Crystal Garland and attaching a Crystal Pendant to the bottom. If you'd like our help with this, just give us a call! We offer our Flower Pomander Kissing Balls in 4 1/2", 6", 8 1/2" and 10 1/2" diameters. Try mixing the sizes and colors! The Roses are gloriously beautiful and full! We shopped and shopped trying to find Rose Balls that looked like real roses, didn't look cheap, but did not have the price tag of fresh flowers. We feel that this style will meet the needs of discerning buyers without a cost that will break the bank.wild-pagewhclde1https://s.yimg.com/aah/shopwildthings/flower-ball-silk-rose-pomander-kissing-ball-4-5-white-56.jpghttps://s.yimg.com/aah/shopwildthings/flower-ball-silk-rose-pomander-kissing-ball-4-5-white-57.jpgOur Kissing Pomander Balls come in a huge variety of colors and are covered in high quality silk roses and are ready to be a key decorating element in your upcoming special day! Hang Pomanders from Shepherd's Hooks, from Manzanita Centerpiece Trees, or from Branches and Sprays in your floral Decor. Top a Vase with a Rose Ball and hang strands of our Crystals from them. Use the attached matching Satin Ribbon to hang them up if you'd like, or remove it and add a strand of pearls (we sell inexpensive Rolls of Pearls!) to hang them from. We think you could also really "fancy them up" by adding a short portion of Crystal Garland and attaching a Crystal Pendant to the bottom. If you'd like our help with this, just give us a call! We offer our Flower Pomander Kissing Balls in 4 1/2", 6", 8 1/2" and 10 1/2" diameters. Try mixing the sizes and colors! The Roses are gloriously beautiful and full! We shopped and shopped trying to find Rose Balls that looked like real roses, didn't look cheap, but did not have the price tag of fresh flowers. We feel that this style will meet the needs of discerning buyers without a cost that will break the bank.wild-pagelimegreendecor1https://s.yimg.com/aah/shopwildthings/flower-ball-silk-rose-pomander-kissing-ball-6-apple-green-146.jpghttps://s.yimg.com/aah/shopwildthings/flower-ball-silk-rose-pomander-kissing-ball-6-apple-green-147.jpgOur Kissing Pomander Balls come in a huge variety of colors and are covered in high quality silk roses and are ready to be a key decorating element in your upcoming special day! Hang Pomanders from Shepherd's Hooks, from Manzanita Centerpiece Trees, or from Branches and Sprays in your floral Decor. Top a Vase with a Rose Ball and hang strands of our Crystals from them. Use the attached matching Satin Ribbon to hang them up if you'd like, or remove it and add a strand of pearls (we sell inexpensive Rolls of Pearls!) to hang them from. We think you could also really "fancy them up" by adding a short portion of Crystal Garland and attaching a Crystal Pendant to the bottom. If you'd like our help with this, just give us a call! We offer our Flower Pomander Kissing Balls in 4 1/2", 6", 8 1/2" and 10 1/2" diameters. Try mixing the sizes and colors! The Roses are gloriously beautiful, and full and about 4" wide. We shopped and shopped trying to find Rose Balls that looked like real roses, didn't look cheap, but did not have the price tag of fresh flowers. We feel that this style will meet the needs of discerning buyers without a cost that will break the bank.wild-pagebltude1https://s.yimg.com/aah/shopwildthings/flower-ball-silk-rose-pomander-kissing-ball-6-blue-140.jpghttps://s.yimg.com/aah/shopwildthings/flower-ball-silk-rose-pomander-kissing-ball-6-blue-141.jpgwild-pagepinks1https://s.yimg.com/aah/shopwildthings/flower-ball-silk-rose-pomander-kissing-ball-6-coral-205.jpghttps://s.yimg.com/aah/shopwildthings/flower-ball-silk-rose-pomander-kissing-ball-6-coral-206.jpgOur Kissing Pomander Balls come in a huge variety of colors and are covered in high quality silk roses and are ready to be a key decorating element in your upcoming special day! Hang Pomanders from Shepherd's Hooks, from Manzanita Centerpiece Trees, or from Branches and Sprays in your floral Decor. Top a Vase with a Rose Ball and hang strands of our Crystals from them. Use the attached matching Satin Ribbon to hang them up if you'd like, or remove it and add a strand of pearls (we sell inexpensive Rolls of Pearls!) to hang them from. We think you could also really "fancy them up" by adding a short portion of Crystal Garland and attaching a Crystal Pendant to the bottom. If you'd like our help with this, just give us a call! We offer our Flower Pomander Kissing Balls in 4 1/2", 6", 8 1/2" and 10 1/2" diameters. Try mixing the sizes and colors! The Roses are gloriously beautiful, and full and about 4" wide. We shopped and shopped trying to find Rose Balls that looked like real roses, didn't look cheap, but did not have the price tag of fresh flowers. We feel that this style will meet the needs of discerning buyers without a cost that will break the bank.wild-pagereddecor1https://s.yimg.com/aah/shopwildthings/flower-ball-silk-rose-pomander-kissing-ball-6-fuchsia-158.jpghttps://s.yimg.com/aah/shopwildthings/flower-ball-silk-rose-pomander-kissing-ball-6-fuchsia-159.jpgOur Kissing Pomander Balls come in a huge variety of colors and are covered in high quality silk roses and are ready to be a key decorating element in your upcoming special day! Hang Pomanders from Shepherd's Hooks, from Manzanita Centerpiece Trees, or from Branches and Sprays in your floral Decor. Top a Vase with a Rose Ball and hang strands of our Crystals from them. Use the attached matching Satin Ribbon to hang them up if you'd like, or remove it and add a strand of pearls (we sell inexpensive Rolls of Pearls!) to hang them from. We think you could also really "fancy them up" by adding a short portion of Crystal Garland and attaching a Crystal Pendant to the bottom. If you'd like our help with this, just give us a call! We offer our Flower Pomander Kissing Balls in 4 1/2", 6", 8 1/2" and 10 1/2" diameters. Try mixing the sizes and colors! The Roses are gloriously beautiful, and full and about 4" wide. We shopped and shopped trying to find Rose Balls that looked like real roses, didn't look cheap, but did not have the price tag of fresh flowers. We feel that this style will meet the needs of discerning buyers without a cost that will break the bank.wild-pagegolddecor1https://s.yimg.com/aah/shopwildthings/flower-ball-silk-rose-pomander-kissing-ball-6-gold-57.jpghttps://s.yimg.com/aah/shopwildthings/flower-ball-silk-rose-pomander-kissing-ball-6-gold-58.jpgOur Kissing Pomander Balls come in a huge variety of colors and are covered in high quality silk roses and are ready to be a key decorating element in your upcoming special day! Hang Pomanders from Shepherd's Hooks, from Manzanita Centerpiece Trees, or from Branches and Sprays in your floral Decor. Top a Vase with a Rose Ball and hang strands of our Crystals from them. Use the attached matching Satin Ribbon to hang them up if you'd like, or remove it and add a strand of pearls (we sell inexpensive Rolls of Pearls!) to hang them from. We think you could also really "fancy them up" by adding a short portion of Crystal Garland and attaching a Crystal Pendant to the bottom. If you'd like our help with this, just give us a call! We offer our Flower Pomander Kissing Balls in 4 1/2", 6", 8 1/2" and 10 1/2" diameters. Try mixing the sizes and colors! The Roses are gloriously beautiful, and full and about 3" wide. We shopped and shopped trying to find Rose Balls that looked like real roses, didn't look cheap, but did not have the price tag of fresh flowers. We feel that this style will meet the needs of discerning buyers without a cost that will break the bank.wild-pagelimegreendecor1https://s.yimg.com/aah/shopwildthings/flower-ball-silk-rose-pomander-kissing-ball-6-ivory-218.jpghttps://s.yimg.com/aah/shopwildthings/flower-ball-silk-rose-pomander-kissing-ball-6-ivory-219.jpgOur Kissing Pomander Balls come in a huge variety of colors and are covered in high quality silk roses and are ready to be a key decorating element in your upcoming special day! Hang Pomanders from Shepherd's Hooks, from Manzanita Centerpiece Trees, or from Branches and Sprays in your floral Decor. Top a Vase with a Rose Ball and hang strands of our Crystals from them. Use the attached matching Satin Ribbon to hang them up if you'd like, or remove it and add a strand of pearls (we sell inexpensive Rolls of Pearls!) to hang them from. We think you could also really "fancy them up" by adding a short portion of Crystal Garland and attaching a Crystal Pendant to the bottom. If you'd like our help with this, just give us a call! We offer our Flower Pomander Kissing Balls in 4 1/2", 6", 8 1/2" and 10 1/2" diameters. Try mixing the sizes and colors! The Roses are gloriously beautiful, and full and about 4" wide. We shopped and shopped trying to find Rose Balls that looked like real roses, didn't look cheap, but did not have the price tag of fresh flowers. We feel that this style will meet the needs of discerning buyers without a cost that will break the bank.wild-pagereddecor1https://s.yimg.com/aah/shopwildthings/flower-ball-silk-rose-pomander-kissing-ball-6-orange-108.jpghttps://s.yimg.com/aah/shopwildthings/flower-ball-silk-rose-pomander-kissing-ball-6-orange-109.jpgOur Kissing Pomander Balls come in a huge variety of colors and are covered in high quality silk roses and are ready to be a key decorating element in your upcoming special day! Hang Pomanders from Shepherd's Hooks, from Manzanita Centerpiece Trees, or from Branches and Sprays in your floral Decor. Top a Vase with a Rose Ball and hang strands of our Crystals from them. Use the attached matching Satin Ribbon to hang them up if you'd like, or remove it and add a strand of pearls (we sell inexpensive Rolls of Pearls!) to hang them from. We think you could also really "fancy them up" by adding a short portion of Crystal Garland and attaching a Crystal Pendant to the bottom. If you'd like our help with this, just give us a call! We offer our Flower Pomander Kissing Balls in 4 1/2", 6", 8 1/2" and 10 1/2" diameters. Try mixing the sizes and colors! The Roses are gloriously beautiful, and full and about 4" wide. We shopped and shopped trying to find Rose Balls that looked like real roses, didn't look cheap, but did not have the price tag of fresh flowers. We feel that this style will meet the needs of discerning buyers without a cost that will break the bank.wild-pagereddecor1https://s.yimg.com/aah/shopwildthings/flower-ball-silk-rose-pomander-kissing-ball-6-pink-210.jpghttps://s.yimg.com/aah/shopwildthings/flower-ball-silk-rose-pomander-kissing-ball-6-pink-211.jpgOur Kissing Pomander Balls come in a huge variety of colors and are covered in high quality silk roses and are ready to be a key decorating element in your upcoming special day! Hang Pomanders from Shepherd's Hooks, from Manzanita Centerpiece Trees, or from Branches and Sprays in your floral Decor. Top a Vase with a Rose Ball and hang strands of our Crystals from them. Use the attached matching Satin Ribbon to hang them up if you'd like, or remove it and add a strand of pearls (we sell inexpensive Rolls of Pearls!) to hang them from. We think you could also really "fancy them up" by adding a short portion of Crystal Garland and attaching a Crystal Pendant to the bottom. If you'd like our help with this, just give us a call! We offer our Flower Pomander Kissing Balls in 4 1/2", 6", 8 1/2" and 10 1/2" diameters. Try mixing the sizes and colors! The Roses are gloriously beautiful, and full and about 4" wide. We shopped and shopped trying to find Rose Balls that looked like real roses, didn't look cheap, but did not have the price tag of fresh flowers. We feel that this style will meet the needs of discerning buyers without a cost that will break the bank.wild-pagepurplestuff1https://s.yimg.com/aah/shopwildthings/flower-ball-silk-rose-pomander-kissing-ball-6-purple-323.jpghttps://s.yimg.com/aah/shopwildthings/flower-ball-silk-rose-pomander-kissing-ball-6-purple-324.jpgOur Kissing Pomander Balls come in a huge variety of colors and are covered in high quality silk roses and are ready to be a key decorating element in your upcoming special day! Hang Pomanders from Shepherd's Hooks, from Manzanita Centerpiece Trees, or from Branches and Sprays in your floral Decor. Top a Vase with a Rose Ball and hang strands of our Crystals from them. Use the attached matching Satin Ribbon to hang them up if you'd like, or remove it and add a strand of pearls (we sell inexpensive Rolls of Pearls!) to hang them from. We think you could also really "fancy them up" by adding a short portion of Crystal Garland and attaching a Crystal Pendant to the bottom. If you'd like our help with this, just give us a call! We offer our Flower Pomander Kissing Balls in 4 1/2", 6", 8 1/2" and 10 1/2" diameters. Try mixing the sizes and colors! The Roses are gloriously beautiful, and full and about 4" wide. We shopped and shopped trying to find Rose Balls that looked like real roses, didn't look cheap, but did not have the price tag of fresh flowers. We feel that this style will meet the needs of discerning buyers without a cost that will break the bank.wild-pageropokiba1https://s.yimg.com/aah/shopwildthings/flower-ball-silk-rose-pomander-kissing-ball-6-red-296.jpghttps://s.yimg.com/aah/shopwildthings/flower-ball-silk-rose-pomander-kissing-ball-6-red-297.jpgOur Kissing Pomander Balls come in a huge variety of colors and are covered in high quality silk roses and are ready to be a key decorating element in your upcoming special day! Hang Pomanders from Shepherd's Hooks, from Manzanita Centerpiece Trees, or from Branches and Sprays in your floral Decor. Top a Vase with a Rose Ball and hang strands of our Crystals from them. Use the attached matching Satin Ribbon to hang them up if you'd like, or remove it and add a strand of pearls (we sell inexpensive Rolls of Pearls!) to hang them from. We think you could also really "fancy them up" by adding a short portion of Crystal Garland and attaching a Crystal Pendant to the bottom. If you'd like our help with this, just give us a call! We offer our Flower Pomander Kissing Balls in 4 1/2", 6", 8 1/2" and 10 1/2" diameters. Try mixing the sizes and colors! The Roses are gloriously beautiful, and full and about 4" wide. We shopped and shopped trying to find Rose Balls that looked like real roses, didn't look cheap, but did not have the price tag of fresh flowers. We feel that this style will meet the needs of discerning buyers without a cost that will break the bank.wild-pageropokiba1https://s.yimg.com/aah/shopwildthings/flower-ball-silk-rose-pomander-kissing-ball-6-royal-blue-277.jpghttps://s.yimg.com/aah/shopwildthings/flower-ball-silk-rose-pomander-kissing-ball-6-royal-blue-278.jpgwild-pageropokiba1https://s.yimg.com/aah/shopwildthings/flower-ball-silk-rose-pomander-kissing-ball-6-silver-57.jpghttps://s.yimg.com/aah/shopwildthings/flower-ball-silk-rose-pomander-kissing-ball-6-silver-58.jpgOur Kissing Pomander Balls come in a huge variety of colors and are covered in high quality silk roses and are ready to be a key decorating element in your upcoming special day! Hang Pomanders from Shepherd's Hooks, from Manzanita Centerpiece Trees, or from Branches and Sprays in your floral Decor. Top a Vase with a Rose Ball and hang strands of our Crystals from them. Use the attached matching Satin Ribbon to hang them up if you'd like, or remove it and add a strand of pearls (we sell inexpensive Rolls of Pearls!) to hang them from. We think you could also really "fancy them up" by adding a short portion of Crystal Garland and attaching a Crystal Pendant to the bottom. If you'd like our help with this, just give us a call! We offer our Flower Pomander Kissing Balls in 4 1/2", 6", 8 1/2" and 10 1/2" diameters. Try mixing the sizes and colors! The Roses are gloriously beautiful, and full and about 3" wide. We shopped and shopped trying to find Rose Balls that looked like real roses, didn't look cheap, but did not have the price tag of fresh flowers. We feel that this style will meet the needs of discerning buyers without a cost that will break the bank.wild-pagebltude1https://s.yimg.com/aah/shopwildthings/flower-ball-silk-rose-pomander-kissing-ball-6-turquoise-105.jpghttps://s.yimg.com/aah/shopwildthings/flower-ball-silk-rose-pomander-kissing-ball-6-turquoise-106.jpgOur Kissing Pomander Balls come in a huge variety of colors and are covered in high quality silk roses and are ready to be a key decorating element in your upcoming special day! Hang Pomanders from Shepherd's Hooks, from Manzanita Centerpiece Trees, or from Branches and Sprays in your floral Decor. Top a Vase with a Rose Ball and hang strands of our Crystals from them. Use the attached matching Satin Ribbon to hang them up if you'd like, or remove it and add a strand of pearls (we sell inexpensive Rolls of Pearls!) to hang them from. We think you could also really "fancy them up" by adding a short portion of Crystal Garland and attaching a Crystal Pendant to the bottom. If you'd like our help with this, just give us a call! We offer our Flower Pomander Kissing Balls in 4 1/2", 6", 8 1/2" and 10 1/2" diameters. Try mixing the sizes and colors! The Roses are gloriously beautiful, and full and about 4" wide. We shopped and shopped trying to find Rose Balls that looked like real roses, didn't look cheap, but did not have the price tag of fresh flowers. We feel that this style will meet the needs of discerning buyers without a cost that will break the bank.wild-pageyellowdecor1https://s.yimg.com/aah/shopwildthings/flower-ball-silk-rose-pomander-kissing-ball-6-yellow-215.jpghttps://s.yimg.com/aah/shopwildthings/flower-ball-silk-rose-pomander-kissing-ball-6-yellow-216.jpgOur Kissing Pomander Balls come in a huge variety of colors and are covered in high quality silk roses and are ready to be a key decorating element in your upcoming special day! Hang Pomanders from Shepherd's Hooks, from Manzanita Centerpiece Trees, or from Branches and Sprays in your floral Decor. Top a Vase with a Rose Ball and hang strands of our Crystals from them. Use the attached matching Satin Ribbon to hang them up if you'd like, or remove it and add a strand of pearls (we sell inexpensive Rolls of Pearls!) to hang them from. We think you could also really "fancy them up" by adding a short portion of Crystal Garland and attaching a Crystal Pendant to the bottom. If you'd like our help with this, just give us a call! We offer our Flower Pomander Kissing Balls in 4 1/2", 6", 8 1/2" and 10 1/2" diameters. Try mixing the sizes and colors! The Roses are gloriously beautiful, and full and about 4" wide. We shopped and shopped trying to find Rose Balls that looked like real roses, didn't look cheap, but did not have the price tag of fresh flowers. We feel that this style will meet the needs of discerning buyers without a cost that will break the bank.wild-page1https://s.yimg.com/aah/shopwildthings/flower-ball-silk-rose-pomander-kissing-ball-8-5-coral-140.jpghttps://s.yimg.com/aah/shopwildthings/flower-ball-silk-rose-pomander-kissing-ball-8-5-coral-141.jpgwild-page1https://s.yimg.com/aah/shopwildthings/flower-ball-silk-rose-pomander-kissing-ball-8-5-pink-187.jpghttps://s.yimg.com/aah/shopwildthings/flower-ball-silk-rose-pomander-kissing-ball-8-5-pink-188.jpgwild-page1https://s.yimg.com/aah/shopwildthings/flower-ball-silk-rose-pomander-kissing-ball-8-5-purple-252.jpghttps://s.yimg.com/aah/shopwildthings/flower-ball-silk-rose-pomander-kissing-ball-8-5-purple-253.jpgwild-pagelimegreendecor1https://s.yimg.com/aah/shopwildthings/flower-ball-silk-rose-pomander-kissing-ball-8-5-apple-green-115.jpghttps://s.yimg.com/aah/shopwildthings/flower-ball-silk-rose-pomander-kissing-ball-8-5-apple-green-116.jpgOur Kissing Pomander Balls come in a huge variety of colors and are covered in high quality silk roses and are ready to be a key decorating element in your upcoming special day! Hang Pomanders from Shepherd's Hooks, from Manzanita Centerpiece Trees, or from Branches and Sprays in your floral Decor. Top a Vase with a Rose Ball and hang strands of our Crystals from them. Use the attached matching Satin Ribbon to hang them up if you'd like, or remove it and add a strand of pearls (we sell inexpensive Rolls of Pearls!) to hang them from. We think you could also really "fancy them up" by adding a short portion of Crystal Garland and attaching a Crystal Pendant to the bottom. If you'd like our help with this, just give us a call! We offer our Flower Pomander Kissing Balls in 4 1/2", 6", 8 1/2" and 10 1/2" diameters. Try mixing the sizes and colors! The Roses are gloriously beautiful, and full and about 4" wide. We shopped and shopped trying to find Rose Balls that looked like real roses, didn't look cheap, but did not have the price tag of fresh flowers. We feel that this style will meet the needs of discerning buyers without a cost that will break the bank.wild-pagelimegreendecor1https://s.yimg.com/aah/shopwildthings/flower-ball-silk-rose-pomander-kissing-ball-8-5-aqua-128.jpghttps://s.yimg.com/aah/shopwildthings/flower-ball-silk-rose-pomander-kissing-ball-8-5-aqua-129.jpgOur Kissing Pomander Balls come in a huge variety of colors and are covered in high quality silk roses and are ready to be a key decorating element in your upcoming special day! Hang Pomanders from Shepherd's Hooks, from Manzanita Centerpiece Trees, or from Branches and Sprays in your floral Decor. Top a Vase with a Rose Ball and hang strands of our Crystals from them. Use the attached matching Satin Ribbon to hang them up if you'd like, or remove it and add a strand of pearls (we sell inexpensive Rolls of Pearls!) to hang them from. We think you could also really "fancy them up" by adding a short portion of Crystal Garland and attaching a Crystal Pendant to the bottom. If you'd like our help with this, just give us a call! We offer our Flower Pomander Kissing Balls in 4 1/2", 6", 8 1/2" and 10 1/2" diameters. Try mixing the sizes and colors! The Roses are gloriously beautiful, and full and about 4" wide. We shopped and shopped trying to find Rose Balls that looked like real roses, didn't look cheap, but did not have the price tag of fresh flowers. We feel that this style will meet the needs of discerning buyers without a cost that will break the bank.wild-pageblackdecor1https://s.yimg.com/aah/shopwildthings/flower-ball-silk-rose-pomander-kissing-ball-8-5-black-186.jpghttps://s.yimg.com/aah/shopwildthings/flower-ball-silk-rose-pomander-kissing-ball-8-5-black-187.jpgOur Kissing Pomander Balls come in a huge variety of colors and are covered in high quality silk roses and are ready to be a key decorating element in your upcoming special day! Hang Pomanders from Shepherd's Hooks, from Manzanita Centerpiece Trees, or from Branches and Sprays in your floral Decor. Top a Vase with a Rose Ball and hang strands of our Crystals from them. Use the attached matching Satin Ribbon to hang them up if you'd like, or remove it and add a strand of pearls (we sell inexpensive Rolls of Pearls!) to hang them from. We think you could also really "fancy them up" by adding a short portion of Crystal Garland and attaching a Crystal Pendant to the bottom. If you'd like our help with this, just give us a call! We offer our Flower Pomander Kissing Balls in 4 1/2", 6", 8 1/2" and 10 1/2" diameters. Try mixing the sizes and colors! The Roses are gloriously beautiful, and full and about 4" wide. We shopped and shopped trying to find Rose Balls that looked like real roses, didn't look cheap, but did not have the price tag of fresh flowers. We feel that this style will meet the needs of discerning buyers without a cost that will break the bank.wild-pagebltude1https://s.yimg.com/aah/shopwildthings/flower-ball-silk-rose-pomander-kissing-ball-85-blue-96.jpghttps://s.yimg.com/aah/shopwildthings/flower-ball-silk-rose-pomander-kissing-ball-85-blue-97.jpgOur Kissing Pomander Balls come in a huge variety of colors and are covered in high quality silk roses and are ready to be a key decorating element in your upcoming special day! Hang Pomanders from Shepherd's Hooks, from Manzanita Centerpiece Trees, or from Branches and Sprays in your floral Decor. Top a Vase with a Rose Ball and hang strands of our Crystals from them. Use the attached matching Satin Ribbon to hang them up if you'd like, or remove it and add a strand of pearls (we sell inexpensive Rolls of Pearls!) to hang them from. We think you could also really "fancy them up" by adding a short portion of Crystal Garland and attaching a Crystal Pendant to the bottom. If you'd like our help with this, just give us a call! We offer our Flower Pomander Kissing Balls in 4 1/2", 6", 8 1/2" and 10 1/2" diameters. Try mixing the sizes and colors! The Roses are gloriously beautiful, and full and about 4" wide. We shopped and shopped trying to find Rose Balls that looked like real roses, didn't look cheap, but did not have the price tag of fresh flowers. We feel that this style will meet the needs of discerning buyers without a cost that will break the bank.wild-pagebrowndecor1https://s.yimg.com/aah/shopwildthings/flower-ball-silk-rose-pomander-kissing-ball-8-5-brown-125.jpghttps://s.yimg.com/aah/shopwildthings/flower-ball-silk-rose-pomander-kissing-ball-8-5-brown-126.jpgOur Kissing Pomander Balls come in a huge variety of colors and are covered in high quality silk roses and are ready to be a key decorating element in your upcoming special day! Hang Pomanders from Shepherd's Hooks, from Manzanita Centerpiece Trees, or from Branches and Sprays in your floral Decor. Top a Vase with a Rose Ball and hang strands of our Crystals from them. Use the attached matching Satin Ribbon to hang them up if you'd like, or remove it and add a strand of pearls (we sell inexpensive Rolls of Pearls!) to hang them from. We think you could also really "fancy them up" by adding a short portion of Crystal Garland and attaching a Crystal Pendant to the bottom. If you'd like our help with this, just give us a call! We offer our Flower Pomander Kissing Balls in 4 1/2", 6", 8 1/2" and 10 1/2" diameters. Try mixing the sizes and colors! The Roses are gloriously beautiful, and full and about 4" wide. We shopped and shopped trying to find Rose Balls that looked like real roses, didn't look cheap, but did not have the price tag of fresh flowers. We feel that this style will meet the needs of discerning buyers without a cost that will break the bank.wild-pagepinks1https://s.yimg.com/aah/shopwildthings/flower-ball-silk-rose-pomander-kissing-ball-8-5-coral-142.jpghttps://s.yimg.com/aah/shopwildthings/flower-ball-silk-rose-pomander-kissing-ball-8-5-coral-143.jpgOur Kissing Pomander Balls come in a huge variety of colors and are covered in high quality silk roses and are ready to be a key decorating element in your upcoming special day! Hang Pomanders from Shepherd's Hooks, from Manzanita Centerpiece Trees, or from Branches and Sprays in your floral Decor. Top a Vase with a Rose Ball and hang strands of our Crystals from them. Use the attached matching Satin Ribbon to hang them up if you'd like, or remove it and add a strand of pearls (we sell inexpensive Rolls of Pearls!) to hang them from. We think you could also really "fancy them up" by adding a short portion of Crystal Garland and attaching a Crystal Pendant to the bottom. If you'd like our help with this, just give us a call! We offer our Flower Pomander Kissing Balls in 4 1/2", 6", 8 1/2" and 10 1/2" diameters. Try mixing the sizes and colors! The Roses are gloriously beautiful, and full and about 4" wide. We shopped and shopped trying to find Rose Balls that looked like real roses, didn't look cheap, but did not have the price tag of fresh flowers. We feel that this style will meet the needs of discerning buyers without a cost that will break the bank.wild-pagereddecor1https://s.yimg.com/aah/shopwildthings/flower-ball-silk-rose-pomander-kissing-ball-8-5-fuchsia-149.jpghttps://s.yimg.com/aah/shopwildthings/flower-ball-silk-rose-pomander-kissing-ball-8-5-fuchsia-150.jpgOur Kissing Pomander Balls come in a huge variety of colors and are covered in high quality silk roses and are ready to be a key decorating element in your upcoming special day! Hang Pomanders from Shepherd's Hooks, from Manzanita Centerpiece Trees, or from Branches and Sprays in your floral Decor. Top a Vase with a Rose Ball and hang strands of our Crystals from them. Use the attached matching Satin Ribbon to hang them up if you'd like, or remove it and add a strand of pearls (we sell inexpensive Rolls of Pearls!) to hang them from. We think you could also really "fancy them up" by adding a short portion of Crystal Garland and attaching a Crystal Pendant to the bottom. If you'd like our help with this, just give us a call! We offer our Flower Pomander Kissing Balls in 4 1/2", 6", 8 1/2" and 10 1/2" diameters. Try mixing the sizes and colors! The Roses are gloriously beautiful, and full and about 4" wide. We shopped and shopped trying to find Rose Balls that looked like real roses, didn't look cheap, but did not have the price tag of fresh flowers. We feel that this style will meet the needs of discerning buyers without a cost that will break the bank.wild-pagegolddecor1https://s.yimg.com/aah/shopwildthings/flower-ball-silk-rose-pomander-kissing-ball-8-5-gold-58.jpghttps://s.yimg.com/aah/shopwildthings/flower-ball-silk-rose-pomander-kissing-ball-8-5-gold-59.jpgOur Kissing Pomander Balls come in a huge variety of colors and are covered in high quality silk roses and are ready to be a key decorating element in your upcoming special day! Hang Pomanders from Shepherd's Hooks, from Manzanita Centerpiece Trees, or from Branches and Sprays in your floral Decor. Top a Vase with a Rose Ball and hang strands of our Crystals from them. Use the attached matching Satin Ribbon to hang them up if you'd like, or remove it and add a strand of pearls (we sell inexpensive Rolls of Pearls!) to hang them from. We think you could also really "fancy them up" by adding a short portion of Crystal Garland and attaching a Crystal Pendant to the bottom. If you'd like our help with this, just give us a call! We offer our Flower Pomander Kissing Balls in 4 1/2", 6", 8 1/2" and 10 1/2" diameters. Try mixing the sizes and colors! The Roses are gloriously beautiful, and full and about 4" wide. We shopped and shopped trying to find Rose Balls that looked like real roses, didn't look cheap, but did not have the price tag of fresh flowers. We feel that this style will meet the needs of discerning buyers without a cost that will break the bank.wild-pagelimegreendecor1https://s.yimg.com/aah/shopwildthings/flower-ball-silk-rose-pomander-kissing-ball-8-5-ivory-161.jpghttps://s.yimg.com/aah/shopwildthings/flower-ball-silk-rose-pomander-kissing-ball-8-5-ivory-162.jpgOur Kissing Pomander Balls come in a huge variety of colors and are covered in high quality silk roses and are ready to be a key decorating element in your upcoming special day! Hang Pomanders from Shepherd's Hooks, from Manzanita Centerpiece Trees, or from Branches and Sprays in your floral Decor. Top a Vase with a Rose Ball and hang strands of our Crystals from them. Use the attached matching Satin Ribbon to hang them up if you'd like, or remove it and add a strand of pearls (we sell inexpensive Rolls of Pearls!) to hang them from. We think you could also really "fancy them up" by adding a short portion of Crystal Garland and attaching a Crystal Pendant to the bottom. If you'd like our help with this, just give us a call! We offer our Flower Pomander Kissing Balls in 4 1/2", 6", 8 1/2" and 10 1/2" diameters. Try mixing the sizes and colors! The Roses are gloriously beautiful, and full and about 4" wide. We shopped and shopped trying to find Rose Balls that looked like real roses, didn't look cheap, but did not have the price tag of fresh flowers. We feel that this style will meet the needs of discerning buyers without a cost that will break the bank.wild-pagereddecor1https://s.yimg.com/aah/shopwildthings/flower-ball-silk-rose-pomander-kissing-ball-8-5-pink-189.jpghttps://s.yimg.com/aah/shopwildthings/flower-ball-silk-rose-pomander-kissing-ball-8-5-pink-190.jpgOur Kissing Pomander Balls come in a huge variety of colors and are covered in high quality silk roses and are ready to be a key decorating element in your upcoming special day! Hang Pomanders from Shepherd's Hooks, from Manzanita Centerpiece Trees, or from Branches and Sprays in your floral Decor. Top a Vase with a Rose Ball and hang strands of our Crystals from them. Use the attached matching Satin Ribbon to hang them up if you'd like, or remove it and add a strand of pearls (we sell inexpensive Rolls of Pearls!) to hang them from. We think you could also really "fancy them up" by adding a short portion of Crystal Garland and attaching a Crystal Pendant to the bottom. If you'd like our help with this, just give us a call! We offer our Flower Pomander Kissing Balls in 4 1/2", 6", 8 1/2" and 10 1/2" diameters. Try mixing the sizes and colors! The Roses are gloriously beautiful, and full and about 4" wide. We shopped and shopped trying to find Rose Balls that looked like real roses, didn't look cheap, but did not have the price tag of fresh flowers. We feel that this style will meet the needs of discerning buyers without a cost that will break the bank.wild-pageropokiba1https://s.yimg.com/aah/shopwildthings/flower-ball-silk-rose-pomander-kissing-ball-8-5-purple-254.jpghttps://s.yimg.com/aah/shopwildthings/flower-ball-silk-rose-pomander-kissing-ball-8-5-purple-255.jpgOur Kissing Pomander Balls come in a huge variety of colors and are covered in high quality silk roses and are ready to be a key decorating element in your upcoming special day! Hang Pomanders from Shepherd's Hooks, from Manzanita Centerpiece Trees, or from Branches and Sprays in your floral Decor. Top a Vase with a Rose Ball and hang strands of our Crystals from them. Use the attached matching Satin Ribbon to hang them up if you'd like, or remove it and add a strand of pearls (we sell inexpensive Rolls of Pearls!) to hang them from. We think you could also really "fancy them up" by adding a short portion of Crystal Garland and attaching a Crystal Pendant to the bottom. If you'd like our help with this, just give us a call! We offer our Flower Pomander Kissing Balls in 4 1/2", 6", 8 1/2" and 10 1/2" diameters. Try mixing the sizes and colors! The Roses are gloriously beautiful, and full and about 4" wide. We shopped and shopped trying to find Rose Balls that looked like real roses, didn't look cheap, but did not have the price tag of fresh flowers. We feel that this style will meet the needs of discerning buyers without a cost that will break the bank.wild-pagereddecor1https://s.yimg.com/aah/shopwildthings/flower-ball-silk-rose-pomander-kissing-ball-8-5-red-259.jpghttps://s.yimg.com/aah/shopwildthings/flower-ball-silk-rose-pomander-kissing-ball-8-5-red-260.jpgOur Kissing Pomander Balls come in a huge variety of colors and are covered in high quality silk roses and are ready to be a key decorating element in your upcoming special day! Hang Pomanders from Shepherd's Hooks, from Manzanita Centerpiece Trees, or from Branches and Sprays in your floral Decor. Top a Vase with a Rose Ball and hang strands of our Crystals from them. Use the attached matching Satin Ribbon to hang them up if you'd like, or remove it and add a strand of pearls (we sell inexpensive Rolls of Pearls!) to hang them from. We think you could also really "fancy them up" by adding a short portion of Crystal Garland and attaching a Crystal Pendant to the bottom. If you'd like our help with this, just give us a call! We offer our Flower Pomander Kissing Balls in 4 1/2", 6", 8 1/2" and 10 1/2" diameters. Try mixing the sizes and colors! The Roses are gloriously beautiful, and full and about 4" wide. We shopped and shopped trying to find Rose Balls that looked like real roses, didn't look cheap, but did not have the price tag of fresh flowers. We feel that this style will meet the needs of discerning buyers without a cost that will break the bank.wild-pagebltude1https://s.yimg.com/aah/shopwildthings/flower-ball-silk-rose-pomander-kissing-ball-8-5-royal-blue-185.jpghttps://s.yimg.com/aah/shopwildthings/flower-ball-silk-rose-pomander-kissing-ball-8-5-royal-blue-186.jpgOur Kissing Pomander Balls come in a huge variety of colors and are covered in high quality silk roses and are ready to be a key decorating element in your upcoming special day! Hang Pomanders from Shepherd's Hooks, from Manzanita Centerpiece Trees, or from Branches and Sprays in your floral Decor. Top a Vase with a Rose Ball and hang strands of our Crystals from them. Use the attached matching Satin Ribbon to hang them up if you'd like, or remove it and add a strand of pearls (we sell inexpensive Rolls of Pearls!) to hang them from. We think you could also really "fancy them up" by adding a short portion of Crystal Garland and attaching a Crystal Pendant to the bottom. If you'd like our help with this, just give us a call! We offer our Flower Pomander Kissing Balls in 4 1/2", 6", 8 1/2" and 10 1/2" diameters. Try mixing the sizes and colors! The Roses are gloriously beautiful, and full and about 4" wide. We shopped and shopped trying to find Rose Balls that looked like real roses, didn't look cheap, but did not have the price tag of fresh flowers. We feel that this style will meet the needs of discerning buyers without a cost that will break the bank.wild-pagesilverdecor1https://s.yimg.com/aah/shopwildthings/flower-ball-silk-rose-pomander-kissing-ball-8-5-silver-58.jpghttps://s.yimg.com/aah/shopwildthings/flower-ball-silk-rose-pomander-kissing-ball-8-5-silver-59.jpgOur Kissing Pomander Balls come in a huge variety of colors and are covered in high quality silk roses and are ready to be a key decorating element in your upcoming special day! Hang Pomanders from Shepherd's Hooks, from Manzanita Centerpiece Trees, or from Branches and Sprays in your floral Decor. Top a Vase with a Rose Ball and hang strands of our Crystals from them. Use the attached matching Satin Ribbon to hang them up if you'd like, or remove it and add a strand of pearls (we sell inexpensive Rolls of Pearls!) to hang them from. We think you could also really "fancy them up" by adding a short portion of Crystal Garland and attaching a Crystal Pendant to the bottom. If you'd like our help with this, just give us a call! We offer our Flower Pomander Kissing Balls in 4 1/2", 6", 8 1/2" and 10 1/2" diameters. Try mixing the sizes and colors! The Roses are gloriously beautiful, and full and about 4" wide. We shopped and shopped trying to find Rose Balls that looked like real roses, didn't look cheap, but did not have the price tag of fresh flowers. We feel that this style will meet the needs of discerning buyers without a cost that will break the bank.wild-pagebltude1https://s.yimg.com/aah/shopwildthings/flower-ball-silk-rose-pomander-kissing-ball-8-5-turquoise-138.jpghttps://s.yimg.com/aah/shopwildthings/flower-ball-silk-rose-pomander-kissing-ball-8-5-turquoise-139.jpgOur Kissing Pomander Balls come in a huge variety of colors and are covered in high quality silk roses and are ready to be a key decorating element in your upcoming special day! Hang Pomanders from Shepherd's Hooks, from Manzanita Centerpiece Trees, or from Branches and Sprays in your floral Decor. Top a Vase with a Rose Ball and hang strands of our Crystals from them. Use the attached matching Satin Ribbon to hang them up if you'd like, or remove it and add a strand of pearls (we sell inexpensive Rolls of Pearls!) to hang them from. We think you could also really "fancy them up" by adding a short portion of Crystal Garland and attaching a Crystal Pendant to the bottom. If you'd like our help with this, just give us a call! We offer our Flower Pomander Kissing Balls in 4 1/2", 6", 8 1/2" and 10 1/2" diameters. Try mixing the sizes and colors! The Roses are gloriously beautiful, and full and about 4" wide. We shopped and shopped trying to find Rose Balls that looked like real roses, didn't look cheap, but did not have the price tag of fresh flowers. We feel that this style will meet the needs of discerning buyers without a cost that will break the bank.wild-pagelimegreendecor1https://s.yimg.com/aah/shopwildthings/flower-ball-silk-rose-pomander-kissing-ball-8-5-white-189.jpghttps://s.yimg.com/aah/shopwildthings/flower-ball-silk-rose-pomander-kissing-ball-8-5-white-190.jpgOur Kissing Pomander Balls come in a huge variety of colors and are covered in high quality silk roses and are ready to be a key decorating element in your upcoming special day! Hang Pomanders from Shepherd's Hooks, from Manzanita Centerpiece Trees, or from Branches and Sprays in your floral Decor. Top a Vase with a Rose Ball and hang strands of our Crystals from them. Use the attached matching Satin Ribbon to hang them up if you'd like, or remove it and add a strand of pearls (we sell inexpensive Rolls of Pearls!) to hang them from. We think you could also really "fancy them up" by adding a short portion of Crystal Garland and attaching a Crystal Pendant to the bottom. If you'd like our help with this, just give us a call! We offer our Flower Pomander Kissing Balls in 4 1/2", 6", 8 1/2" and 10 1/2" diameters. Try mixing the sizes and colors! The Roses are gloriously beautiful, and full and about 4" wide. We shopped and shopped trying to find Rose Balls that looked like real roses, didn't look cheap, but did not have the price tag of fresh flowers. We feel that this style will meet the needs of discerning buyers without a cost that will break the bank.wild-pageyellowdecor1https://s.yimg.com/aah/shopwildthings/flower-ball-silk-rose-pomander-kissing-ball-8-5-yellow-126.jpghttps://s.yimg.com/aah/shopwildthings/flower-ball-silk-rose-pomander-kissing-ball-8-5-yellow-127.jpgOur Kissing Pomander Balls come in a huge variety of colors and are covered in high quality silk roses and are ready to be a key decorating element in your upcoming special day! Hang Pomanders from Shepherd's Hooks, from Manzanita Centerpiece Trees, or from Branches and Sprays in your floral Decor. Top a Vase with a Rose Ball and hang strands of our Crystals from them. Use the attached matching Satin Ribbon to hang them up if you'd like, or remove it and add a strand of pearls (we sell inexpensive Rolls of Pearls!) to hang them from. We think you could also really "fancy them up" by adding a short portion of Crystal Garland and attaching a Crystal Pendant to the bottom. If you'd like our help with this, just give us a call! We offer our Flower Pomander Kissing Balls in 4 1/2", 6", 8 1/2" and 10 1/2" diameters. Try mixing the sizes and colors! The Roses are gloriously beautiful, and full and about 4" wide. We shopped and shopped trying to find Rose Balls that looked like real roses, didn't look cheap, but did not have the price tag of fresh flowers. We feel that this style will meet the needs of discerning buyers without a cost that will break the bank.wild-pagepinks1https://s.yimg.com/aah/shopwildthings/flower-ball-silk-rose-pomander-kissing-ball-6-1-2-dusty-pink-34.jpghttps://s.yimg.com/aah/shopwildthings/flower-ball-silk-rose-pomander-kissing-ball-6-1-2-dusty-pink-35.jpgWedding Arch. These also look spectacular hanging from Manzanita Centerpiece Trees, from Branches and Sprays or when used on a flower wall backdrop. Top a Centerpiece Vase with a Rose Ball for a simple yet very elegant accent piece. These floral balls are so easy to work with and if you'd like to make them a bit more ritzy, use Pearl or Crystal Garland Strands to hang the balls or insert some strands into the Styrofoam for added glamour. For flower girls and the bridal party, it doesn't get much easier than using these quality flower balls and they become a favorite memento for years to come! The hard Styrofoam center securely holds the flowers so you don't have to worry like you do with real, fragile flowers. We offer our Flower Pomander Kissing Balls in many sizes, colors and styles so you're sure to find the perfect flowers to fit your occasion! The Roses are gloriously beautiful and full! We shopped and shopped trying to find Rose Balls that looked like real roses, didn't look cheap, but did not have the price tag of fresh flowers. We feel that this style will meet the needs of discerning buyers without a cost that will break the bank!]]>wild-pagepurplestuff1https://s.yimg.com/aah/shopwildthings/flower-ball-silk-rose-pomander-kissing-ball-6-1-2-lavender-41.jpghttps://s.yimg.com/aah/shopwildthings/flower-ball-silk-rose-pomander-kissing-ball-6-1-2-lavender-42.jpgWedding Arch. These also look spectacular hanging from Manzanita Centerpiece Trees, from Branches and Sprays or when used on a flower wall backdrop. Top a Centerpiece Vase with a Rose Ball for a simple yet very elegant accent piece. These floral balls are so easy to work with and if you'd like to make them a bit more ritzy, use Pearl or Crystal Garland Strands to hang the balls or insert some strands into the Styrofoam for added glamour. For flower girls and the bridal party, it doesn't get much easier than using these quality flower balls and they become a favorite memento for years to come! The hard Styrofoam center securely holds the flowers so you don't have to worry like you do with real, fragile flowers. We offer our Flower Pomander Kissing Balls in many sizes, colors and styles so you're sure to find the perfect flowers to fit your occasion! The Roses are gloriously beautiful and full! We shopped and shopped trying to find Rose Balls that looked like real roses, didn't look cheap, but did not have the price tag of fresh flowers. We feel that this style will meet the needs of discerning buyers without a cost that will break the bank!]]>wild-pagepurplestuff1https://s.yimg.com/aah/shopwildthings/flower-ball-silk-rose-pomander-kissing-ball-9-1-2-lavender-41.jpghttps://s.yimg.com/aah/shopwildthings/flower-ball-silk-rose-pomander-kissing-ball-9-1-2-lavender-42.jpgWedding Arch. These also look spectacular hanging from Manzanita Centerpiece Trees, from Branches and Sprays or when used on a flower wall backdrop. Top a Centerpiece Vase with a Rose Ball for a simple yet very elegant accent piece. These floral balls are so easy to work with and if you'd like to make them a bit more ritzy, use Pearl or Crystal Garland Strands to hang the balls or insert some strands into the Styrofoam for added glamour. For flower girls and the bridal party, it doesn't get much easier than using these quality flower balls and they become a favorite memento for years to come! The hard Styrofoam center securely holds the flowers so you don't have to worry like you do with real, fragile flowers. We offer our Flower Pomander Kissing Balls in many sizes, colors and styles so you're sure to find the perfect flowers to fit your occasion! The Roses are gloriously beautiful and full! We shopped and shopped trying to find Rose Balls that looked like real roses, didn't look cheap, but did not have the price tag of fresh flowers. We feel that this style will meet the needs of discerning buyers without a cost that will break the bank!]]>wild-pagewhclde1https://s.yimg.com/aah/shopwildthings/flower-ball-10-premium-silk-roses-peonies-hydrangeas-pure-white-32.jpghttps://s.yimg.com/aah/shopwildthings/flower-ball-10-premium-silk-roses-peonies-hydrangeas-pure-white-33.jpgWith this 1 flower ball, you really get 2 toppers for vases or risers! In the main photo, the upper left shows the whole flower ball, the upper rights shows the ball split into 2 halves and the bottom center shows half of the ball sitting on a vase. So very elegant and so very full, our Pure White Flower Ball is 9 3/4" in diameter and bursting with lovely silk flowers that are huge and luscious! Each ball splits into 2 halves so you can use this Pomander Kissing Ball in a variety of ways. There are 14 huge blooms consisting of 7 roses that measure 4" wide by 3" tall and 7 peonies that measure 3 1/2" wide by 3" tall! The remainder of the ball is filled with 2 1/2" wide hydrangeas and the variety and size of flowers makes this ball visually and texturally outstanding! There are green silk leaves popping from the base of the flowers and with a little fluffing, you cannot see the plastic grid frame at all. This is one grandiose item that splits into 2 superior products! For weddings and events, these are ideal for hanging off of pews or for flower girls to carry and they make a treasured, lasting memento! The plastic grid framework makes it easy to attach a ribbon or if you'd like to make them a bit more ritzy, attach White Pearl or Sparkling Crystal Garland Strands. For maximum impact centerpiece Decor, place an entire ball atop a Crystal Beaded Trumpet Vase or split the ball into 2 halves to gain twice the decorating capacity. There are pegs and holes on the frame so you can split and reconnect the halves as much as needed. Each half sphere can sit on a Centerpiece Riser, elevated cake stand or use to outline the cake table or make a floral, serpentine table runner. These half balls can also be attached to flower walls or stapled to actual walls. For outdoor ceremonies, hang from trees, tents and arches or create a romantic aisle walkway by hanging them from shepherds' hooks. These floral accent balls are so easy to work with and give a huge visual impact. We offer our Flower Pomander Kissing Balls in many sizes, colors and styles so you're sure to find the perfect flowers to fit your occasion! We shopped and shopped trying to find quality flower balls that are jam-packed with blooms that look like real flowers, without the expense of fresh flowers. We feel that the superiority and style of these decorative accent pieces will meet the needs of discerning buyers with a cost that won't break the bank!]]>wild-pagesilkflowers1https://s.yimg.com/aah/shopwildthings/blue-hydrangea-flower-balls-48.jpghttps://s.yimg.com/aah/shopwildthings/blue-hydrangea-flower-balls-49.jpgShepherds' Hooks to line an aisle, hang from a ceremony arch, gazeebo or even trees. The ribbon loops make this ideal to slide onto pipe and drape kits or use Hanging Hooks to hang from any structure like an overhead trellis. No hardware to hang this garland from? No problem! This lightweight garland can simply be stapled or tacked to a wall in a design of your choice to provide a backdrop for the head table! This also makes an excellent table runner centerpiece for a garden party or drape it on the front of a table to add color and glamour!]]>wild-pagesilkflowers1https://s.yimg.com/aah/shopwildthings/ivory-hydrangea-flower-balls-wedding-decor-41.jpghttps://s.yimg.com/aah/shopwildthings/ivory-hydrangea-flower-balls-wedding-decor-42.jpgShepherds' Hooks to line an aisle, hang from a ceremony arch, gazeebo or even trees. The ribbon loops make this ideal to slide onto pipe and drape kits or use Hanging Hooks to hang from any structure like an overhead trellis. No hardware to hang this garland from? No problem! This lightweight garland can simply be stapled or tacked to a wall in a design of your choice to provide a backdrop for the head table! This also makes an excellent table runner centerpiece for a garden party or drape it on the front of a table to add texture and glamour!]]>wild-pagesilkflowers1https://s.yimg.com/aah/shopwildthings/pink-hydrangea-flower-garland-ball-41.jpghttps://s.yimg.com/aah/shopwildthings/pink-hydrangea-flower-garland-ball-42.jpgShepherds' Hooks to line an aisle, hang from a ceremony arch, gazeebo or even trees. The ribbon loops make this ideal to slide onto pipe and drape kits or use Hanging Hooks to hang from any structure like an overhead trellis. No hardware to hang this garland from? No problem! This lightweight garland can simply be stapled or tacked to a wall in a design of your choice to provide a backdrop for the head table! This also makes an excellent table runner centerpiece for a garden party or drape it on the front of a table to add color and glamour!]]>wild-pagelimegreendecor11https://s.yimg.com/aah/shopwildthings/flower-bouquet-holders-floral-foam-set-of-6-each-3-x-7-30.jpghttps://s.yimg.com/aah/shopwildthings/flower-bouquet-holders-floral-foam-set-of-6-each-3-x-7-31.jpgSilk Ivory Rose Spray which has 7 heads. Snip off each stem at the desired length and poke into the foam. A dab of hot glue on the end of the stem gives additional security. Add height with orchids and eucalyptus sprays or create a cascading effect with draping blooms like wisteria and Amaranthus. Baby's Breath is an excellent filler as are the blooms of our flowering tree branches and snips of small leafy green sprays brings the bouquet all together. Our faux florals not only offer you top quality silk selections, but the array of colors and varying textures provide you with a large range of choices. Other materials you can add are tulle, feathers and snips of curly glitter sprays. For materials that don't have a stiff stem, like our delicate and beautiful White Pearl Beaded Garland, simply secure them to the plastic cage surrounding the foam head. At the base of the foam head, add greenery like pieces of a Silk Grape Leaf Vine to complete the look. These holders are also ideal for creating pew decorations and for decorating wedding arches. There are countless styles of bouquets and you deserve to see your vision come true. Be inspired by your own creativity and you can't fail. ]]>wild-pagebrandnewitems1https://s.yimg.com/aah/shopwildthings/clear-glass-bottles-on-colorful-plates-4-colors-available-cutest-things-ever-90.jpghttps://s.yimg.com/aah/shopwildthings/clear-glass-bottles-on-colorful-plates-4-colors-available-cutest-things-ever-91.jpgSucculents. The vivid color on the plate is so peppy and along with this bright lime green, we also have fuchsia pink, purple and orange. Using the 4 together makes a very energetic and happy centerpiece! The bottles have a rim so you can tie thin ribbons for added color and another idea is to place delicate butterflies or Textured Diamond Confetti on the plate for added pop! ]]>wild-pageorangedecor1https://s.yimg.com/aah/shopwildthings/flower-cutting-holder-orange-plate-7-glass-bottles-34.jpghttps://s.yimg.com/aah/shopwildthings/flower-cutting-holder-orange-plate-7-glass-bottles-35.jpgSucculents. The vivid color on the plate is so peppy and along with this bright orange, we also have fuchsia pink, purple and lime green. Using the 4 together makes a very energetic and happy centerpiece! The bottles have a rim so you can tie thin ribbons for added color and another idea is to place delicate butterflies or Textured Diamond Confetti on the plate for added pop!]]>wild-pagepinks1https://s.yimg.com/aah/shopwildthings/flower-cutting-holder-pink-plate-7-glass-bottles-38.jpghttps://s.yimg.com/aah/shopwildthings/flower-cutting-holder-pink-plate-7-glass-bottles-39.jpgSucculents. The vivid color on the plate is so peppy and along with this bright fuchsia pink, we also have lime green, purple and orange. Using the 4 together makes a very energetic and happy centerpiece! The bottles have a rim so you can tie thin ribbons for added color and another idea is to place delicate butterflies or Textured Diamond Confetti on the plate for added pop!]]>wild-pagepurplestuff1https://s.yimg.com/aah/shopwildthings/flower-cutting-holder-purple-plate-7-glass-bottles-34.jpghttps://s.yimg.com/aah/shopwildthings/flower-cutting-holder-purple-plate-7-glass-bottles-35.jpgSucculents. The vivid color on the plate is so peppy and along with this bright purple, we also have fuchsia pink, lime green and orange. Using the 4 together makes a very energetic and happy centerpiece! The bottles have a rim so you can tie thin ribbons for added color and another idea is to place delicate butterflies or Textured Diamond Confetti on the plate for added pop!]]>wild-pagesilkflowers1https://s.yimg.com/aah/shopwildthings/flower-garland-extra-fancy-white-silk-plumeria-over-7-long-bendable-wire-71.jpghttps://s.yimg.com/aah/shopwildthings/flower-garland-extra-fancy-white-silk-plumeria-over-7-long-bendable-wire-72.jpgPlease note: the main photo shows several of the garlands hanging in one photo to give you a design idea. If you order one, you will get ONE fabulous garland that is 7 Feet Long. Order more than 1 to create the look of several garlands hanging. Our garlands have invisible wire inside, which is a HUGE deal. This means that you can position them how you want and they'll stay like that. This dreamy floral garland is so versatile and the lovely blooms give that romantic, enchanted feeling! The silky soft flowers are approx. 3" wide and the entire length of this garland is 92" which includes a 14" flexible plastic stem and wire that you can bend, wrap, join to another garland or use to attach it to Wedding Arches or Shepherds' Hooks, railings or use to suspend from ceiling hooks. You can join several together to outline a gift and cake table or lay down the center of a table, add some Flameless LED Candles or fairy string lights, maybe add some beaded crystal strands and there"s your centerpiece! The flexibility of this garland allows you to weave it around candles, form a wreath or create a circle of flowers. Whether your event is traditional, tropical, rustic or garden-themed, this ornamental Plumeria Flower Garland can easily be translated to stress-free decorating for your perfect day!]]>wild-pagesilkflowers1https://s.yimg.com/aah/shopwildthings/aqua-blue-flower-garlands-backdrops-parties-24.jpghttps://s.yimg.com/aah/shopwildthings/aqua-blue-flower-garlands-backdrops-parties-25.jpg
Create a dreamy flower filled rose extravaganza by pairing with our matching Silk Rose Pomander Kissing Balls that are available in several sizes!]]>wild-pagesilkflowers1https://s.yimg.com/aah/shopwildthings/hanging-floral-garland-wedding-backdrop-23.jpghttps://s.yimg.com/aah/shopwildthings/hanging-floral-garland-wedding-backdrop-24.jpg
Create a dreamy flower filled rose extravaganza by pairing with our matching Silk Rose Pomander Kissing Balls that are available in several sizes!]]>wild-pagesilkflowers1https://s.yimg.com/aah/shopwildthings/flower-garland-backdrop-pink-roses-23.jpghttps://s.yimg.com/aah/shopwildthings/flower-garland-backdrop-pink-roses-24.jpg
Create a dreamy flower filled rose extravaganza by pairing with our matching Silk Rose Pomander Kissing Balls that are available in several sizes or our Pink Rose and Plumeria Flower Wall!]]>wild-pagesilkflowers1https://s.yimg.com/aah/shopwildthings/pink-roses-flower-garlands-backdrop-hanging-24.jpghttps://s.yimg.com/aah/shopwildthings/pink-roses-flower-garlands-backdrop-hanging-25.jpg
Create a dreamy flower filled rose extravaganza by pairing with our matching Silk Rose Pomander Kissing Balls that are available in several sizes!]]>wild-pagesilkflowers1https://s.yimg.com/aah/shopwildthings/rose-garland-wedding-backdrop-purple-green-23.jpghttps://s.yimg.com/aah/shopwildthings/rose-garland-wedding-backdrop-purple-green-24.jpg
Create a dreamy flower filled rose extravaganza by pairing with our matching Silk Rose Pomander Kissing Balls that are available in several sizes!]]>wild-pagesilkflowers1https://s.yimg.com/aah/shopwildthings/red-rose-garland-wedding-47.jpghttps://s.yimg.com/aah/shopwildthings/red-rose-garland-wedding-48.jpg
Create a dreamy flower filled rose extravaganza by pairing with our matching Silk Rose Pomander Kissing Balls that are available in several sizes!]]>wild-pagesilkflowers1https://s.yimg.com/aah/shopwildthings/flower-garland-silk-rose-8-royal-blue-81.jpghttps://s.yimg.com/aah/shopwildthings/flower-garland-silk-rose-8-royal-blue-82.jpg
Create a dreamy flower filled rose extravaganza by pairing with our matching Silk Rose Pomander Kissing Balls that are available in several sizes!]]>wild-pagesilkflowers1https://s.yimg.com/aah/shopwildthings/flower-garland-silk-rose-8-white-75.jpghttps://s.yimg.com/aah/shopwildthings/flower-garland-silk-rose-8-white-76.jpg
Create a dreamy flower filled rose extravaganza by pairing with our matching Silk Rose Pomander Kissing Balls that are available in several sizes!]]>wild-pagesilkflowers1https://s.yimg.com/aah/shopwildthings/flower-garland-with-pearls-flex-handle-malana-white-30-98.jpghttps://s.yimg.com/aah/shopwildthings/flower-garland-with-pearls-flex-handle-malana-white-30-99.jpgLittle Dainty Flowers with a bendable cluster on top - perfect for floral centerpieces or to add to your bouquet! Every little detail counts when planning your special day and we get just how important it is to have every element look amazing, perform beautifully and last throughout the day. From hanging ceiling decor to table centerpieces and large floor vases, our aim is to provide you with superior products that save you decorating time while being sophisticated and glamorous. The main photo shows FOUR of these items hanging right next to each other. If you order 1 piece, you will get 1 of these garland that each has it's own hanging bouquet at the top and 6 strands of flowers hanging from it. Start with details like our charming Hanging Flower Garland "Malana" which means calming, relaxing and light - the perfect description for this soft and delicate garland that enhances wedding decor and adds elegance wherever it's used. Malana is 30" long with an additional 3" flexible hanging loop. At the top of this garland is a 4" bouquet of flowers encircled by a sheer, silvery bow. Streaming down from the bouquet are 6 strands of snow white flowers with faux pearl centers and at the end of each strand is a crystal clear faceted bead. The strands vary from 21" to 26" long and are attached with flexible wire so you can somewhat spread them out and the flowers are strung on clear monofilament line so they appear to be floating! Classy and graceful! The hanging loop is firm but bendable so you can round it out in a circle or condense it to an oval and you can position it straight up or completely horizontal. This versatile loop makes it very convenient to hang in a variety of areas. Use Malana to create spectacular ceiling decor by hanging from chandeliers or overhead structures. For instance, on a drop-ceiling, use magnetic hooks on the metal grids or hang from any horizontal line, wire, twine or rope and let the cascading strands create a romantic overhead flower garden. Hang from a balcony, trellis, pergola, pavilion, gazebo or party tents. As a centerpiece, place the loop around the base of a flameless LED candle and let the delicate flowers puddle onto a mirror. Use as aisle decor with shepherds' hooks, use as pew markers, hang on door knobs, hang from wedding arches, decorate a dessert table, incorporate into a bridal bouquet or adorn a flower girls basket. A breathtaking product to save you time while creating glamorous event decor!wild-pagesilkflowers1https://s.yimg.com/aah/shopwildthings/flower-garland-with-bead-clusters-kaleen-white-70-97.jpghttps://s.yimg.com/aah/shopwildthings/flower-garland-with-bead-clusters-kaleen-white-70-98.jpgwild-pagetrees-and-floralflower-ball-ivory-8inch-silk-flowersivory-flower-ball-10inch-hanging-decorationhydrangea-silk-flower-ball-ivory-6inchesflower-rose-pomander-ivory-4inchesflower-ball-kissing-ball-ivory-roses-small-pomanderivory-roses-flower-ball-large-kissing-balls-pomanderivory-wedding-rose-flower-balls-10inchespremium-silk-flower-pomander-pure-cream-10inchespremium-silk-flower-pomander-pure-cream-14inchesfoam-petal-rose-ball-ivory-7inchesfoam-petal-rose-ball-ivory-8inchesfoam-petal-rose-ball-ivory-9inchesfoam-petal-rose-ball-ivory-12inchesfoam-petal-rose-ball-baby-ivory-13inchesivory-kissing-balls-wedding-centerpiece-garlandhydrangea-silk-flower-ball-white-6incheshydrangea-silk-flower-ball-white-10incheskissing-balls-weddings-white-silk-roses-4inchwedding-white-roses-flower-ball-kissing-balls-large-pomanderwhite-round-flower-ball-10inchespremium-silk-flower-pomander-pure-white-10inchesfoam-petal-rose-ball-white-7inchesfoam-petal-rose-ball-white-8inchesfoam-petal-rose-ball-white-10inchesfoam-petal-rose-ball-white-9inchesfoam-petal-rose-ball-white-12inchesfoam-petal-rose-ball-white-13inchesblush-pink-silk-hydrangea-ball-8inchpink-kissing-ball-8inch-silk-hydrangeasilk-flower-ball-10inch-pink-wedding-flowerspink-hydrangea-hanging-silk-flowerball-12inchhydrangea-silk-flower-ball-pink-6inchesround-hanging-flower-ball-pink-roses-small-pomanderpink-roses-round-flower-ball-large-8-5-inch-pomandercoral-8-5-inch-rose-ball-hanging-pomanderhydrangea-silk-flower-ball-coral-6incheshanging-flower-balls-silk-rose-coral-pomandersilk-kissing-ball-pink-roses-7inch-hangingpink-wedding-rose-ball-hanging-10inchfoam-petal-rose-ball-baby-pink-6inchesfoam-petal-rose-ball-baby-pink-10inchesfoam-petal-rose-ball-baby-pink-12inchesfoam-petal-rose-ball-baby-pink-13inchespomander-balls-garland-wedding-flowershang-or-floating-flower-ball-pink-wedding-rosesartificial-rose-balls-floating-flowersflower-balls-silk-rose-fuchsia-pink-small-pomanderfuchsia-pink-roses-kissing-ball-large-pomanderhydrangea-silk-flower-ball-fuchsia-10incheshydrangea-silk-flower-ball-fuchsia-6incheshanging-silk-flowers-kissing-ball-7inch-lavenderlavender-silk-rose-ball-10inch-hangingpurple-hanging-roses-flower-ball-small-pomanderpurple-8-5-inch-kissing-ball-large-roses-pomanderhydrangea-silk-flower-ball-purple-6inchesblue-flower-balls-roses-six-inches-pomanderblue-roses-hanging-kissing-balls-large-pomanderroyal-blue-small-round-kissing-flower-ball-pomanderdark-blue-roses-kissing-balls-flower-rose-ball-pomanderhydrangea-silk-flower-ball-dark-blue-10inchesflower-ball-roses-aqua-blue-6-inches-pomanderhanging-flower-ball-turquoise-blue-roses-small-pomanderaqua-blue-silk-rose-round-flower-ball-8-5-inches-pomanderturquoise-blue-large-rose-ball-kissing-balls-pomanderhydrangea-silk-flower-ball-blue-6incheshydrangea-silk-flower-ball-aqua-10incheshydrangea-silk-flower-ball-blue-10incheshydrangea-silk-flower-ball-royal-blue-10incheshydrangea-silk-flower-ball-royal-blue-6incheshanging-wedding-flowers-kissing-balls-on-ribbonflower-ball-apple-green-kissing-ball-pomanderapple-green-silk-roses-flower-ball-large-pomanderboxwood-ball-topiary-4-inches-event-centerpieceboxwood-topiary-ball-artificial-7inchesboxwood-topiary-ball-2-halves-10inchesboxwood-topiary-ball-2-halves-14inchesred-kissing-ball-flower-ball-6-inches-pomanderred-roses-ball-round-hanging-large-pomandersilk-kissing-ball-red-hanging-flowers-10inchred-silk-8inch-hydrangea-wedding-flowershydrangea-silk-flower-ball-red-6incheshydrangea-silk-flower-ball-red-10inchesfoam-petal-rose-ball-red-6inchesfoam-petal-rose-ball-red-10inchesfoam-petal-rose-ball-red-12inchesfoam-petal-rose-ball-red-13incheskissing-balls-orange-5-inch-round-pomanderorange-flower-kissing-ball-largeyellow-roses-round-flower-ball-kissing-ball-6inch-pomanderrose-ball-kissing-yellow-large-pomandersilver-roses-kissing-flower-ball-6inchessilver-wedding-kissing-ball-roses-8-5inchesgold-wedding-rose-flower-ball-6inchesgold-silk-roses-kissing-flower-ball-8-5inchesbrown-8-5-inch-roses-kissing-ball-pomanderblack-large-rose-flower-ball-pomanderrose-bud-silk-ivory-28inchesrose-bud-silk-red-28inchesaqua-silk-roses-flower-garland-8ftcoral-silk-roses-flower-garland-8ftpink-silk-roses-flower-garland-8ftfuchsia-silk-roses-flower-garland-8ftpurple-silk-roses-flower-garland-8ftroyalblue-silk-roses-flower-garland-8ftred-silk-roses-flower-garland-8ftwhite-silk-roses-flower-garland-8ft4pc-silk-rose-flower-wall-set-red4pc-silk-rose-flower-wall-set-white4pc-silk-rose-flower-wall-set-ivory4pc-silk-rose-flower-wall-set-pinkfoam-roses-wall-backdrop4-giant-ivory-real-feel-foam-roseslarge-pink-foam-flowers-wallscapejumbo-faux-flowers-with-removable-stemgiant-red-silk-flower-prophuge-flower-props-aisle-decorationsoversized-red-silk-rosesgigantic-silk-roses-removable-stemgiant-pink-silk-flowers-removable-stemjumbo-artificial-pink-roses-with-stemoversize-silk-flower-propsoversized-faux-flower-decorationsjumbo-ivory-silk-rose-propsgiant-silk-flowers-for-propshuge-ivory-silk-roses-removable-stemgiant-foam-floating-rose-with-stem-ivory-17inchhuge-white-foam-flower-20inch-wide20inch-wide-giant-foam-flower-ivory1inch-foam-roses-144pc-ivory-wedding-flowersmini-rose-set-144pc-white-1inch-foam-flowersfloating-foam-rose-stem-ivory-15inchesfloating-foam-rose-stem-white-15inchespink-floating-roses-2inch-foam-12pcsfoam-floating-pink-roses-3inch-12pcsfloating-foam-roses-pink-100pcsfloating-foam-rose-flowers-2inch-ivory-12pcsfloating-foam-roses-3inch-ivoryfloating-foam-roses-ivory-100pcsfloating-foam-roses-coral-100pcswhite-floating-foam-roses-12pcs-2inchwhite-wedding-roses-3inch-real-feel-foamfloating-foam-roses-white-100pcsreal-feel-dark-blue-floating-rosesfloating-roses-real-feel-foam-purple1https://s.yimg.com/aah/shopwildthings/rose-pomander-kissing-balls-88.jpghttps://s.yimg.com/aah/shopwildthings/rose-pomander-kissing-balls-89.jpg
Make sure to check out our huge selection of Vases and Centerpiece Risers that hold these beautifully. You can hang on Shepherd's Hooks to line a wedding ceremony aisle, add to Wedding Arches, hang from Manzanita Trees or simply place them on a table. These are ideal for flower girls to carry and you don't have to worry about them wilting or being crushed. To make them fancier add Strands of Beads or Acrylic Pendants!

We offer Silk and Foam Flower Balls in a fabulous selection of colors and sizes at affordable prices. A special feature of the foam balls is that you can float them in water and this looks absolutely gorgeous! Make your special day even more special with these Rose or Hydrangea Pomander Kissing Balls that are the ultimate in floral Decor!]]>wild-pagefloral-walls-greenery-backdrops1https://s.yimg.com/aah/shopwildthings/flower-walls-backdrops-for-sale-50.jpghttps://s.yimg.com/aah/shopwildthings/flower-walls-backdrops-for-sale-51.jpg*The plastic frame is 15 3/4" by 23 1/2" but the flowers extend over the edges making the actual measurement about 16 1/2" by 24" and it's 2 1/2" deep. Full of classy Silk Roses that are about 3 1/2" in diameter and splendid Hydrangea flowers that are approx. 2" wide, this wall only weighs 12 oz. The flowers are attached to a sturdy, white plastic grid frame that is completely flexible. Two sides of the frame have plastic pegs which insert into the holes on the other two sides of the frame so you can attach as many mats as you need to cover areas small or large. The flowers extend over the edge of the mat so the grid is pretty well hidden. The mat is so flexible that you can actually attach the mat to itself, creating a circular floral vase! The plastic grids are 1" by 1 1/2" which makes it super easy to work with for attaching the frame to another surface or for intertwining Fairy String Lights. We'd recommend floral wire or wire ties as an extra measure for keeping them secure or simply staple-gun the mat to a solid surface. Create breath-taking wedding and event decor by attaching to a trellis, gazebo or pavilion. Mix materials and fashion a stunning wall of flowers and Artificial Greenery & Foliage behind a head table which can double as an elegant photo backdrop. The plastic grid frame can easily be cut if need be. This White Rose and Hydrangea Panel looks exceptional with a border of our Green Hydrangea Wall Mats. Budget friendly and lightweight, the design allows for many display possibilities and it works well to mask columns, walls and doors. Making over a ceiling with floral canopies is easier than ever with this awesome flower wall and for added glam, you can attach Sparkling Crystal Garlands and Pendants. Many, many ways to use this Floral Wall Mat to make your dream garden a reality! Take a peek here at Tina's Tips & Tricks Video to see flower panels up close, how to snap them together and how they look mounted on a wall. Also, please see the video below where Katie features this actual flower wall, as well as this style in other colors. TO AVOID THE LOOK OF "SEAMS" ON A FLOWER WALL USING A PIPE AND DRAPE STRUCTURE: The most critical point is to make sure that each wall panel is secured in multiple spots, not only to the pipes but to each adjoining panel as well. The tie should be a material that won't relax or stretch like burlap twine, wire ties or zip ties. When displaying multiple panels next to each other, each wall needs to be pulled taut so the seams don't show. The flowers extend over the frame, hiding the pipes while creating a seamless look. Another key is to secure each panel to the pipe AND to the adjoining panel in at least 3 spots. You can also connect the panels by using the pegs & holes on the sides of the plastic frame. Additionally, running picture wire horizontally, vertically and diagonally on the pipe and drape structure before adding the walls allows for a firmer background to support the walls.]]>wild-pagefloral-walls-greenery-backdrops11https://s.yimg.com/aah/shopwildthings/silk-plumeria-frangipani-flower-walls-romantic-red-dark-seeds-16-x-24-44.jpghttps://s.yimg.com/aah/shopwildthings/silk-plumeria-frangipani-flower-walls-romantic-red-dark-seeds-16-x-24-45.jpg*The plastic frame is 15 1/2" by 23 1/2" but the flowers extend over the edges making the actual measurement about 17 1/2" by 24 1/2" and it's 2" deep. Chocked full of soft and luscious hydrangea blooms that are each approx. 2" wide. The coloring on this flower wall is awesome and the finish is semi-shiny. The lavish shade of red gets darker towards the center which has dark brown/black seeds. Lots of detail that adds up to lots of depth and visual impact on this wall! Truly fit for black-tie events! This mat only weighs 12 oz. which allows for many display possibilities. The flowers are attached to a sturdy, plastic grid frame that is completely flexible. Two sides of the frame have plastic pegs which insert into the holes on the other two sides of the frame so you can attach as many mats as you need to cover areas small or large. The flowers extend over the edge of the mat so the grid is pretty well hidden. The mat is so flexible that you can actually attach the mat to itself, creating a circular floral vase! The grids are an inch square which makes it super easy to work with for attaching the frame to another surface. Create breath-taking wedding and event decor by attaching to a trellis or an arch. Fashion a stunning wall of flowers behind a head table which can double as an elegant photo backdrop. Use to mask or enhance a column, wall or door and accent with a colorful rose monogram or logo to mark the occasion! If you want to create a design with other materials you can easily part the flowers and use the grid to attach items. If hanging from a wall or fence, use the grids to intertwine Fairy String Lights to give a soft illumination or create a border with a complementary color like our Semi-Gloss Black Flower Wall. Very classy! This mat is an ideal size to use on drop ceilings with metal grids. Create a magical floral canopy by suspending the mat with magnet hooks, crystal or pearl strands. Hang Sparkling Crystal Ornaments for added glam. If you need a wall that will be seen from both sides, use the easily accessible grids and tie 2 mats back-to-back. You can even cut the plastic grid frame to make creative shapes. Many, many ways to use this Floral Wall Mat to make your dream garden a reality! Take a peek here at Tina's Tips & Tricks Video to see flower panels up close, how to snap them together and how they look mounted on a wall. Also, please see the video below where Katie features this actual flower wall, as well as our red flower wall with white seeds! TO AVOID THE LOOK OF "SEAMS" ON A FLOWER WALL USING A PIPE AND DRAPE STRUCTURE: The most critical point is to make sure that each wall panel is secured in multiple spots, not only to the pipes but to each adjoining panel as well. The tie should be a material that won't relax or stretch like burlap twine, wire ties or zip ties. When displaying multiple panels next to each other, each wall needs to be pulled taut so the seams don't show. The flowers extend over the frame, hiding the pipes while creating a seamless look. Another key is to secure each panel to the pipe AND to the adjoining panel in at least 3 spots. You can also connect the panels by using the pegs & holes on the sides of the plastic frame. Additionally, running picture wire horizontally, vertically and diagonally on the pipe and drape structure before adding the walls allows for a firmer background to support the walls.]]>wild-pagewhclde11https://s.yimg.com/aah/shopwildthings/artificial-flower-wall-backdrop-22.jpghttps://s.yimg.com/aah/shopwildthings/artificial-flower-wall-backdrop-23.jpg*The frame is 15 3/4" by 23 1/4" but the flowers extend over the edges making the actual measurement about 17" x 24 1/2" and it's 1 1/2" deep. Chocked full of glorious Hydrangea flowers, each soft and luscious bloom is approx. 2" wide and this mat only weighs 12 oz. which allows for many display possibilities. This mat is a bit less dense than most we carry (hence the price difference between this mat and our Premium line) but attaching to a white backdrop works beautifully. The flowers are attached to a sturdy, plastic grid frame that is completely flexible. Two sides of the frame have plastic pegs which insert into the holes on the other two sides of the frame so you can attach as many mats as you need to cover areas small or large. The flowers extend over the edge of the mat and it's so flexible that you can actually attach the mat to itself, creating a circular floral vase! The grids are an inch square which makes it super easy to work with for attaching the frame to another surface. We'd recommend floral wire or wire ties as an extra measure for keeping them secured. Create breath-taking wedding and event decor by attaching to a trellis or Arch. Fashion a stunning wall of flowers behind a head table which can double as an elegant photo backdrop. Use to mask or enhance a column, wall or door and accent with a colorful rose monogram or logo to mark the occasion! If you want to create a design with other materials you can easily part the flowers and use the grid to attach items. If hanging from a wall or fence, use the grids to intertwine fairy string lights or create dimension with your flower wall by adding refreshing greenery like Silk Vines. This mat is an ideal size to use on drop ceilings with metal grids. Create a dreamy floral canopy by suspending the mat with magnet hooks, crystal or pearl strands. Hang Sparkling Crystal Ornaments for added glam. If you need a wall that will be seen from both sides, use the easily accessible grids and tie 2 mats back-to-back. You can even cut the plastic grid frame to make creative shapes. Many, many ways to use this Floral Wall Mat to make your dream garden a reality! TO AVOID THE LOOK OF "SEAMS" ON A FLOWER WALL USING A PIPE AND DRAPE STRUCTURE: The most critical point is to make sure that each wall panel is secured in multiple spots, not only to the pipes but to each adjoining panel as well. The tie should be a material that won't relax or stretch like burlap twine, wire ties or zip ties. When displaying multiple panels next to each other, each wall needs to be pulled taut so the seams don't show. The flowers extend over the frame, hiding the pipes while creating a seamless look. Another key is to secure each panel to the pipe AND to the adjoining panel in at least 3 spots. You can also connect the panels by using the pegs & holes on the sides of the plastic frame. Additionally, running picture wire horizontally, vertically and diagonally on the pipe and drape structure before adding the walls allows for a firmer background to support the walls. Please view our instructional video.]]>wild-pagestand-alone-flower-wall-backdrop-video-tutorial1https://s.yimg.com/aah/shopwildthings/small-roses-flower-wall-backdrop-64.jpghttps://s.yimg.com/aah/shopwildthings/small-roses-flower-wall-backdrop-65.jpg*The plastic frame is 15 1/2" by 23" but the flowers extend over the edges making the actual measurement about 17" by 25" and it's 4" deep! Chocked full of classy roses, each soft and silky bloom is approx. 1 1/2" wide and this wall only weighs 1.3 lb. This bed of roses adds an incredible amount of depth and dimension to any wallscape because the height of the flowers is staggered from 3" to 4" tall, just like natures' own beauties. Due to the extra long flowers on this wall, they tend to get a bit smashed during shipping. Gently fluff them up to regain their height and fullness. Cream is clean and very appealing, able to stand well on its own yet blends and complements every other color. The roses are attached to a sturdy, plastic grid frame that is completely flexible. To connect one or more mats, insert the plastic pegs on 1 wall into the holes on the 2nd wall and so on. You can attach as many mats as you need to cover areas small or large. The flowers extend over the edge of the mat so the grid is pretty well hidden. The mat is so flexible that you can actually attach the mat to itself, creating a circular floral vase! The grids are an inch square which makes it super easy to work with for attaching the frame to another surface or for intertwining Fairy String Lights. Create a monogram or craft a logo by attaching colorful flower garlands or other flowers to the plastic grid frame. We'd recommend floral wire or wire ties as an extra measure for keeping them secure or simply staple-gun the mat to a solid surface. Create breath-taking wedding and event decor by attaching to a trellis, gazebo or pavilion. Mix materials and fashion a stunning wall of flowers and Artificial Greenery & Foliage behind a head table which can double as an elegant photo backdrop. The plastic grid frame can easily be cut if need be. This Cream Rose Panel also makes an exceptional border for pink, purple, red or green floral wall mats like our Red Hydrangea Flower Wall or mixing with textures like our Boxwood Wall Mats creates a striking visual backdrop. Budget friendly and lightweight, the design allows for many display possibilities and it works well to mask columns, walls and doors. Making over a ceiling with floral canopies is easier than ever with this awesome flower wall and for added glam, you can attach Sparkling Crystal Garlands and Pendants. Many, many ways to use this Floral Wall Mat to make your dream garden a reality! TO AVOID THE LOOK OF "SEAMS" ON A FLOWER WALL USING A PIPE AND DRAPE STRUCTURE: The most critical point is to make sure that each wall panel is secured in multiple spots, not only to the pipes but to each adjoining panel as well. The tie should be a material that won't relax or stretch like burlap twine, wire ties or zip ties. When displaying multiple panels next to each other, each wall needs to be pulled taut so the seams don't show. The flowers extend over the frame, hiding the pipes while creating a seamless look. Another key is to secure each panel to the pipe AND to the adjoining panel in at least 3 spots. You can also connect the panels by using the pegs & holes on the sides of the plastic frame. Additionally, running picture wire horizontally, vertically and diagonally on the pipe and drape structure before adding the walls allows for a firmer background to support the walls. Please view our instructional video.]]>wild-pagefloral-walls-greenery-backdrops1https://s.yimg.com/aah/shopwildthings/flower-wall-17-x-25-silk-cherry-blossoms-blush-pink-71.jpghttps://s.yimg.com/aah/shopwildthings/flower-wall-17-x-25-silk-cherry-blossoms-blush-pink-72.jpg*The plastic frame is 15 1/2" by 23 1/2" but the flowers extend over the edges making the actual measurement about 17" by 25" and it's 2" deep. Delicious Cherry Blossoms adorn this wall and each soft and silky bloom is approx. 2" wide and this wall only weighs 8.5 oz. The subtle blending of soft pink centers into ruffled ivory edges make this an elegant color to mix into any wedding or event Decor theme.

The flowers are attached to a sturdy, plastic grid frame that is completely flexible. Two sides of the frame have plastic pegs which insert into the holes on the other two sides of the frame so you can attach as many mats as you need to cover areas small or large. The flowers extend over the edge of the mat so the grid is pretty well hidden. The mat is so flexible that you can actually attach the mat to itself, creating a circular floral vase! The grids are an inch square which makes it super easy to work with for attaching the frame to another surface or for intertwining Fairy String Lights.

We'd recommend floral wire or wire ties as an extra measure for keeping them secure or simply staple-gun the mat to a solid surface. Create breath-taking wedding and event Decor by attaching to a trellis, gazebo or pavilion. Mix materials and fashion a stunning wall of flowers and Artificial Greenery & Foliage behind a head table which can double as an elegant photo backdrop. The plastic grid frame can easily be cut if need be.

Budget friendly and lightweight, the design allows for many display possibilities and it works well to mask columns, walls and doors. Making over a ceiling with floral canopies is easier than ever with this awesome flower wall and for added glam, you can attach Sparkling Crystal Garlands and Pendants.

Many, many ways to use this Floral Wall Mat to make your dream garden a reality! Take a peek here at Tina's Tips & Tricks Video to see flower panels up close, how to snap them together and how they look mounted on a wall. Also, please see the video below where Katie features this actual flower wall, as well as our cream & white cherry blossom flower wall! TO AVOID THE LOOK OF "SEAMS" ON A FLOWER WALL USING A PIPE AND DRAPE STRUCTURE:
The most critical point is to make sure that each wall panel is secured in multiple spots, not only to the pipes but to each adjoining panel as well. The tie should be a material that won't relax or stretch like burlap twine, wire ties or zip ties. When displaying multiple panels next to each other, each wall needs to be pulled taut so the seams don't show. The flowers extend over the frame, hiding the pipes while creating a seamless look.

Another key is to secure each panel to the pipe AND to the adjoining panel in at least 3 spots. You can also connect the panels by using the pegs & holes on the sides of the plastic frame. Additionally, running picture wire horizontally, vertically and diagonally on the pipe and drape structure before adding the walls allows for a firmer background to support the walls.

Please view our instructional video.]]>wild-pagefloral-walls-greenery-backdrops1https://s.yimg.com/aah/shopwildthings/flower-wall-17-x-25-silk-cherry-blossoms-cream-white-80.jpghttps://s.yimg.com/aah/shopwildthings/flower-wall-17-x-25-silk-cherry-blossoms-cream-white-81.jpg*The plastic frame is 15 1/2" by 23 1/2" but the flowers extend over the edges making the actual measurement about 17" by 25" and it's 2" deep. Delicious Cherry Blossoms adorn this wall and each soft and silky bloom is approx. 2" wide and this wall only weighs 8.5 oz. The subtle blending of light creamy centers into ruffled white edges make this an elegant color to mix into any wedding or event Decor theme.

The flowers are attached to a sturdy, plastic grid frame that is completely flexible. Two sides of the frame have plastic pegs which insert into the holes on the other two sides of the frame so you can attach as many mats as you need to cover areas small or large. The flowers extend over the edge of the mat so the grid is pretty well hidden. The mat is so flexible that you can actually attach the mat to itself, creating a circular floral vase! The grids are an inch square which makes it super easy to work with for attaching the frame to another surface or for intertwining Fairy String Lights.

We'd recommend floral wire or wire ties as an extra measure for keeping them secure or simply staple-gun the mat to a solid surface. Create breath-taking wedding and event Decor by attaching to a trellis, gazebo or pavilion. Mix materials and fashion a stunning wall of flowers and Artificial Greenery & Foliage behind a head table which can double as an elegant photo backdrop. The plastic grid frame can easily be cut if need be.

Budget friendly and lightweight, the design allows for many display possibilities and it works well to mask columns, walls and doors. Making over a ceiling with floral canopies is easier than ever with this awesome flower wall and for added glam, you can attach Sparkling Crystal Garlands and Pendants.

Many, many ways to use this Floral Wall Mat to make your dream garden a reality! Take a peek here at Tina's Tips & Tricks Video to see flower panels up close, how to snap them together and how they look mounted on a wall. Also, please see the video below where Katie features this actual flower wall, as well as our blush pink cherry blossom flower wall! TO AVOID THE LOOK OF "SEAMS" ON A FLOWER WALL USING A PIPE AND DRAPE STRUCTURE:
The most critical point is to make sure that each wall panel is secured in multiple spots, not only to the pipes but to each adjoining panel as well. The tie should be a material that won't relax or stretch like burlap twine, wire ties or zip ties. When displaying multiple panels next to each other, each wall needs to be pulled taut so the seams don't show. The flowers extend over the frame, hiding the pipes while creating a seamless look.

Another key is to secure each panel to the pipe AND to the adjoining panel in at least 3 spots. You can also connect the panels by using the pegs & holes on the sides of the plastic frame. Additionally, running picture wire horizontally, vertically and diagonally on the pipe and drape structure before adding the walls allows for a firmer background to support the walls.

Please view our instructional video.]]>wild-pagefloral-walls-greenery-backdrops1https://s.yimg.com/aah/shopwildthings/blush-pink-flower-wall-panel-shopwildthings-46.jpghttps://s.yimg.com/aah/shopwildthings/blush-pink-flower-wall-panel-shopwildthings-47.jpg*The plastic frame on each mat is bendable and measures 15 1/2" x 23 1/2" but the flowers extend over the edges making the actual measurement about 17" by 25" and it is 2" deep. This mat is full of luscious hydrangea blooms, each approx. 2" wide. This mat only weighs 12 oz. which allows for many display possibilities. The flowers are attached to a sturdy, plastic grid frame that is completely flexible. Two sides of the frame have plastic pegs which insert into the holes on the other two sides of the frame so you can attach as many mats as you need to cover areas small or large. Use to mask or enhance a column, wall or door and it's so flexible that you can actually attach the mat to itself, creating a circular floral vase! The large grids make it super easy to staple gun this frame to another surface. We recommend floral wire or wire ties as an extra measure for keeping them secured. Create breath-taking wedding and event Decor by creating a stunning wall of flowers behind a head table which can double as an elegant photo backdrop. The velvety soft blooms and subtle pink shade makes an ideal playground for Sparkling Butterflies and it's just the right size to use on drop ceilings with metal grids. Create an elegant floral canopy by suspending the mat with magnet hooks and intertwine Fairy String Lights or hang Sparkling Crystal Ornaments for added glam. Many, many ways to use this Floral Wall Mat to make your dream garden a reality! Take a peek here at Tina's Tips & Tricks Video to see flower panels up close, how to snap them together and how they look mounted on a wall. Also, please see the video below where Katie features this actual flower wall, as well as our pink and cream hydrangea flower wall! TO AVOID THE LOOK OF "SEAMS" ON A FLOWER WALL USING A PIPE AND DRAPE STRUCTURE: The most critical point is to make sure that each wall panel is secured in multiple spots, not only to the pipes but to each adjoining panel as well. The tie should be a material that won't relax or stretch like burlap twine, wire ties or zip ties. When displaying multiple panels next to each other, each wall needs to be pulled taut so the seams don't show. The flowers extend over the frame, hiding the pipes while creating a seamless look. Another key is to secure each panel to the pipe AND to the adjoining panel in at least 3 spots. You can also connect the panels by using the pegs & holes on the sides of the plastic frame. Additionally, running picture wire horizontally, vertically and diagonally on the pipe and drape structure before adding the walls allows for a firmer background to support the walls.]]>wild-pagepurplestuff1https://s.yimg.com/aah/shopwildthings/flower-wall-17-x-25-silk-hydrangeas-purple-33.jpghttps://s.yimg.com/aah/shopwildthings/flower-wall-17-x-25-silk-hydrangeas-purple-34.jpg*The plastic frame on each mat is bendable and measures 15 1/2" x 23 1/2" but the flowers extend over the edges making the actual measurement about 17" by 25" and it is 2" deep. This mat is full of luscious hydrangea blooms, each approx. 2" wide. The blooms randomly alter from a deep purple with dark violet centers, to medium blue violet petals and the varying colors add lots of texture and dimension! This mat only weighs 12 oz. which allows for many display possibilities. The flowers are attached to a sturdy, plastic grid frame that is completely flexible. Two sides of the frame have plastic pegs which insert into the holes on the other two sides of the frame so you can attach as many mats as you need to cover areas small or large. Use to mask or enhance a column, wall or door and it's so flexible that you can actually attach the mat to itself, creating a circular floral vase! The large grids make it super easy to staple gun this frame to another surface. We recommend floral wire or wire ties as an extra measure for keeping them secured. Create breath-taking wedding and event decor by creating a stunning wall of flowers behind a head table which can double as an elegant photo backdrop. The velvety soft blooms make an ideal playground for Sparkling Butterfly Garlands and it's just the right size to use on drop ceilings with metal grids. Create an elegant floral canopy by suspending the mat with magnet hooks and intertwine Fairy String Lights or hang Sparkling Crystal Ornaments for added glam. Many, many ways to use this Floral Wall Mat to make your dream garden a reality! Take a peek here at Tina's Tips & Tricks Video to see flower panels up close, how to snap them together and how they look mounted on a wall. Also, please see the video below where Katie features this actual flower wall! TO AVOID THE LOOK OF "SEAMS" ON A FLOWER WALL USING A PIPE AND DRAPE STRUCTURE: The most critical point is to make sure that each wall panel is secured in multiple spots, not only to the pipes but to each adjoining panel as well. The tie should be a material that won't relax or stretch like burlap twine, wire ties or zip ties. When displaying multiple panels next to each other, each wall needs to be pulled taut so the seams don't show. The flowers extend over the frame, hiding the pipes while creating a seamless look. Another key is to secure each panel to the pipe AND to the adjoining panel in at least 3 spots. You can also connect the panels by using the pegs & holes on the sides of the plastic frame. Additionally, running picture wire horizontally, vertically and diagonally on the pipe and drape structure before adding the walls allows for a firmer background to support the walls.]]>wild-pagefloral-walls-greenery-backdrops1https://s.yimg.com/aah/shopwildthings/ivory-flower-wall-hydrangeas-48.jpghttps://s.yimg.com/aah/shopwildthings/ivory-flower-wall-hydrangeas-49.jpg*The plastic frame is 15 1/2" by 23" but the flowers extend over the edges making the actual measurement about 17" by 25" and it's 2" deep. Chocked full of splendid Hydrangea flowers, each soft and silky bloom is approx. 2" wide and this wall only weighs 12 oz. Ivory is clean and very appealing, able to stand well on its own yet blends and complements every other color. The flowers are attached to a sturdy, plastic grid frame that is completely flexible. Two sides of the frame have plastic pegs which insert into the holes on the other two sides of the frame so you can attach as many mats as you need to cover areas small or large. The flowers extend over the edge of the mat so the grid is pretty well hidden. The mat is so flexible that you can actually attach the mat to itself, creating a circular floral vase! The grids are an inch square which makes it super easy to work with for attaching the frame to another surface or for intertwining Fairy String Lights. Create a monogram or craft a logo by attaching colorful flower garlands to the plastic grid frame. We'd recommend floral wire or wire ties as an extra measure for keeping them secure or simply staple-gun the mat to a solid surface. Create breath-taking wedding and event Decor by attaching to a trellis, gazebo or pavilion. Mix materials and fashion a stunning wall of flowers and Artificial Greenery & Foliage behind a head table which can double as an elegant photo backdrop. The plastic grid frame can easily be cut if need be. This Ivory Hydrangea Panel makes an exceptional border for pink or green floral wall mats like our Blush Pink, Peach & Ivory Flower Wall or mixing with textures like our Boxwood Wall Mats creates a striking visual backdrop. Budget friendly and lightweight, the design allows for many display possibilities and it works well to mask columns, walls and doors. Making over a ceiling with floral canopies is easier than ever with this awesome flower wall and for added glam, you can attach Sparkling Crystal Garlands and Pendants. Many, many ways to use this Floral Wall Mat to make your dream garden a reality! Take a peek here at Tina's Tips & Tricks Video to see flower panels up close, how to snap them together and how they look mounted on a wall. Also, please see the video below where Katie features this actual flower wall! TO AVOID THE LOOK OF "SEAMS" ON A FLOWER WALL USING A PIPE AND DRAPE STRUCTURE: The most critical point is to make sure that each wall panel is secured in multiple spots, not only to the pipes but to each adjoining panel as well. The tie should be a material that won't relax or stretch like burlap twine, wire ties or zip ties. When displaying multiple panels next to each other, each wall needs to be pulled taut so the seams don't show. The flowers extend over the frame, hiding the pipes while creating a seamless look. Another key is to secure each panel to the pipe AND to the adjoining panel in at least 3 spots. You can also connect the panels by using the pegs & holes on the sides of the plastic frame. Additionally, running picture wire horizontally, vertically and diagonally on the pipe and drape structure before adding the walls allows for a firmer background to support the walls.]]>wild-pagewhclde11https://s.yimg.com/aah/shopwildthings/flower-wall-17-x-25-silk-hydrangeas-cream-41.jpghttps://s.yimg.com/aah/shopwildthings/flower-wall-17-x-25-silk-hydrangeas-cream-42.jpg*The plastic frame is 15 1/2" by 23" but the flowers extend over the edges making the actual measurement about 17" by 25" and it's 2" deep. Chocked full of splendid Hydrangea flowers, each soft and silky bloom is approx. 2" wide and this wall only weighs 12 oz. The light cream color is fresh and very appealing, able to stand well on its own yet blends and complements every other color. The flowers are attached to a sturdy, plastic grid frame that is completely flexible. Two sides of the frame have plastic pegs which insert into the holes on another side of the frame so you can attach as many mats as you need to cover areas small or large. The flowers extend over the edge of the mat so the grid is pretty well hidden. The mat is so flexible that you can actually attach the mat to itself, creating a circular floral vase! The grids are an inch square which makes it super easy to work with for attaching the frame to another surface or for intertwining Fairy String Lights. Create a monogram or craft a logo by attaching colorful flower garlands to the plastic grid frame. We'd recommend floral wire or wire ties as an extra measure for keeping them secure or simply staple-gun the mat to a solid surface. Create breath-taking wedding and event decor by attaching to a trellis, gazebo or pavilion. Mix materials and fashion a stunning wall of flowers and Artificial Greenery & Foliage behind a head table which can double as an elegant photo backdrop. The plastic grid frame can easily be cut if need be. This Light Cream Hydrangea Panel makes an exceptional border for other textured wall mats like our Blush Pink Roses & Hydrangeas Flower Wall or mixing with luscious greenery like our Boxwood Wall Mat creates a striking visual backdrop. Budget friendly and lightweight, the design allows for many display possibilities and it works well to mask columns, walls and doors. Making over a ceiling with floral canopies is easier than ever with this awesome flower wall and for added glam, you can attach Sparkling Crystal Garlands and Pendants. Many, many ways to use this Floral Wall Mat to make your dream garden a reality! TO AVOID THE LOOK OF "SEAMS" ON A FLOWER WALL USING A PIPE AND DRAPE STRUCTURE: The most critical point is to make sure that each wall panel is secured in multiple spots, not only to the pipes but to each adjoining panel as well. The tie should be a material that won't relax or stretch like burlap twine, wire ties or zip ties. When displaying multiple panels next to each other, each wall needs to be pulled taut so the seams don't show. The flowers extend over the frame, hiding the pipes while creating a seamless look. Another key is to secure each panel to the pipe AND to the adjoining panel in at least 3 spots. You can also connect the panels by using the pegs & holes on the sides of the plastic frame. Additionally, running picture wire horizontally, vertically and diagonally on the pipe and drape structure before adding the walls allows for a firmer background to support the walls. Please view our instructional video.]]>wild-pagegolddecor1https://s.yimg.com/aah/shopwildthings/flower-wall-17-x-25-silk-hydrangeas-metallic-gold-27.jpghttps://s.yimg.com/aah/shopwildthings/flower-wall-17-x-25-silk-hydrangeas-metallic-gold-28.jpg*The plastic frame on each mat is bendable and measures 15 1/2" x 23 1/2" but the flowers extend over the edges making the actual measurement about 17" by 25" and it is 2" deep. This mat is full of luscious hydrangea blooms, each approx. 2" wide. The petals are two-toned and feature a bright metallic gold finish with muted metallic gold edges. This flower wall is simply stunning and it almost glows! Perfect for black-tie events and anniversary celebrations. This mat only weighs 12 oz. which allows for many display possibilities. The flowers are attached to a sturdy, plastic grid frame that is completely flexible. Two sides of the frame have plastic pegs which insert into the holes on the other two sides of the frame so you can attach as many mats as you need to cover areas small or large. Use to mask or enhance a column, wall or door and it's so flexible that you can actually attach the mat to itself, creating a circular floral vase! The large grids make it super easy to staple gun this frame to another surface. We recommend floral wire or wire ties as an extra measure for keeping them secured. Create breath-taking wedding and event decor by creating a stunning wall of flowers behind a head table which can double as an elegant photo backdrop. Alternate panels with our Metallic Silver Flower Wall for a show-stopping silver and gold themed party! And, these mats are just the right size to use on drop ceilings with metal grids. Create an elegant floral canopy by suspending the mat with magnet hooks and intertwine Fairy String Lights, hang sparkling crystal pendants or add a monogram or logo using colorful, Flexible Flower Garlands! Many, many ways to use this Floral Wall Mat to make your dream garden a reality! Take a peek here at Tina's Tips & Tricks Video to see flower panels up close, how to snap them together and how they look mounted on a wall. Also, please see the video below where Katie features this actual flower wall, as well as our metallic silver wall! TO AVOID THE LOOK OF "SEAMS" ON A FLOWER WALL USING A PIPE AND DRAPE STRUCTURE: The most critical point is to make sure that each wall panel is secured in multiple spots, not only to the pipes but to each adjoining panel as well. The tie should be a material that won't relax or stretch like burlap twine, wire ties or zip ties. When displaying multiple panels next to each other, each wall needs to be pulled taut so the seams don't show. The flowers extend over the frame, hiding the pipes while creating a seamless look. Another key is to secure each panel to the pipe AND to the adjoining panel in at least 3 spots. You can also connect the panels by using the pegs & holes on the sides of the plastic frame. Additionally, running picture wire horizontally, vertically and diagonally on the pipe and drape structure before adding the walls allows for a firmer background to support the walls.]]>wild-pagesilverdecor1https://s.yimg.com/aah/shopwildthings/flower-wall-17-x-25-silk-hydrangeas-metallic-silver-27.jpghttps://s.yimg.com/aah/shopwildthings/flower-wall-17-x-25-silk-hydrangeas-metallic-silver-28.jpg*The plastic frame on each mat is bendable and measures 15 1/2" x 23 1/2" but the flowers extend over the edges making the actual measurement about 17" by 25" and it is 2" deep. This mat is full of luscious hydrangea blooms, each approx. 2" wide. Lots of dimension is created with the two-toned petals that feature a bright metallic silver finish with muted metallic silver edges. This flower wall is simply stunning and it almost glows! Perfect for black-tie events and anniversary celebrations. This mat only weighs 12 oz. which allows for many display possibilities. The flowers are attached to a sturdy, plastic grid frame that is completely flexible. Two sides of the frame have plastic pegs which insert into the holes on the other two sides of the frame so you can attach as many mats as you need to cover areas small or large. Use to mask or enhance a column, wall or door and it's so flexible that you can actually attach the mat to itself, creating a circular floral vase! The large grids make it super easy to staple gun this frame to another surface. We recommend floral wire or wire ties as an extra measure for keeping them secured. Create breath-taking wedding and event decor by creating a stunning wall of flowers behind a head table which can double as an elegant photo backdrop. This is the perfect playground for Sparkling Butterfly Garlands or alternate panels with our Metallic Gold Flower Walls for a show-stopping silver and gold themed party! And, these mats are just the right size to use on drop ceilings with metal grids. Create an elegant floral canopy by suspending the mat with magnet hooks and intertwine Fairy String Lights, hang sparkling crystal pendants or add a monogram or logo using colorful, Flexible Silk Flower Garlands! Many, many ways to use this Floral Wall Mat to make your dream garden a reality! Take a peek here at Tina's Tips & Tricks Video to see flower panels up close, how to snap them together and how they look mounted on a wall. Also, please see the video below where Katie features this actual flower wall, as well as our metallic gold wall! TO AVOID THE LOOK OF "SEAMS" ON A FLOWER WALL USING A PIPE AND DRAPE STRUCTURE: The most critical point is to make sure that each wall panel is secured in multiple spots, not only to the pipes but to each adjoining panel as well. The tie should be a material that won't relax or stretch like burlap twine, wire ties or zip ties. When displaying multiple panels next to each other, each wall needs to be pulled taut so the seams don't show. The flowers extend over the frame, hiding the pipes while creating a seamless look. Another key is to secure each panel to the pipe AND to the adjoining panel in at least 3 spots. You can also connect the panels by using the pegs & holes on the sides of the plastic frame. Additionally, running picture wire horizontally, vertically and diagonally on the pipe and drape structure before adding the walls allows for a firmer background to support the walls.]]>wild-pagefloral-walls-greenery-backdrops1https://s.yimg.com/aah/shopwildthings/flower-wall-pink-cream-43.jpghttps://s.yimg.com/aah/shopwildthings/flower-wall-pink-cream-44.jpg*The plastic frame is 16" by 23 5/8" but the flowers extend over the edges making the actual measurement about 17" by 25" and it's 2" deep. Chocked full of splendid Hydrangea flowers, each soft and silky bloom is approx. 2" wide and this wall only weighs 12 oz. The color of this pink and cream flower wall builder is so gorgeous and the variegated petals give amazing depth and visual interest. Some flowers are all pink and some have a pink and cream mix. The flowers are attached to a sturdy, plastic grid frame that is completely flexible. Two sides of the frame have plastic pegs which insert into the holes on the other two sides of the frame so you can attach as many mats as you need to cover areas small or large. The flowers extend over the edge of the mat so the grid is pretty well hidden. The mat is so flexible that you can actually attach the mat to itself, creating a circular floral vase! The grids are an inch square which makes it super easy to work with for attaching the frame to another surface or for intertwining Fairy String Lights. We'd recommend floral wire or wire ties as an extra measure for keeping them secure or simply staple-gun the mat to a solid surface. Create breath-taking wedding and event Decor by attaching to a trellis, gazebo or pavilion. Mix materials and fashion a stunning wall of flowers and Artificial Greenery & Foliage behind a head table which can double as an elegant photo backdrop. The plastic grid frame can easily be cut if need be. Budget friendly and lightweight, the design allows for many display possibilities and it works well to mask columns, walls and doors. Making over a ceiling with floral canopies is easier than ever with this awesome flower wall and for added glam, you can attach Sparkling Crystal Garlands and Pendants. Many, many ways to use this Floral Wall Mat to make your dream garden a reality! Take a peek here at Tina's Tips & Tricks Video to see flower panels up close, how to snap them together and how they look mounted on a wall. Also, please see the video below where Katie features this actual flower wall, as well as our blush pink hydrangea flower wall! TO AVOID THE LOOK OF "SEAMS" ON A FLOWER WALL USING A PIPE AND DRAPE STRUCTURE: The most critical point is to make sure that each wall panel is secured in multiple spots, not only to the pipes but to each adjoining panel as well. The tie should be a material that won't relax or stretch like burlap twine, wire ties or zip ties. When displaying multiple panels next to each other, each wall needs to be pulled taut so the seams don't show. The flowers extend over the frame, hiding the pipes while creating a seamless look. Another key is to secure each panel to the pipe AND to the adjoining panel in at least 3 spots. You can also connect the panels by using the pegs & holes on the sides of the plastic frame. Additionally, running picture wire horizontally, vertically and diagonally on the pipe and drape structure before adding the walls allows for a firmer background to support the walls.]]>wild-pagefloral-walls-greenery-backdrops1https://s.yimg.com/aah/shopwildthings/white-hydrangea-flower-wall-shopwildthings-47.jpghttps://s.yimg.com/aah/shopwildthings/white-hydrangea-flower-wall-shopwildthings-48.jpg*The plastic frame is 15 1/2" by 23" but the flowers extend over the edges making the actual measurement about 17" by 25" and it's 2" deep. Chocked full of splendid Hydrangea flowers, each soft and silky bloom is approx. 2" wide and this wall only weighs 12 oz. White is clean and very appealing, able to stand well on its own yet blends and complements every other color. The flowers are attached to a sturdy, plastic grid frame that is completely flexible. Two sides of the frame have plastic pegs which insert into the holes on the other two sides of the frame so you can attach as many mats as you need to cover areas small or large. The flowers extend over the edge of the mat so the grid is pretty well hidden. The mat is so flexible that you can actually attach the mat to itself, creating a circular floral vase! The grids are an inch square which makes it super easy to work with for attaching the frame to another surface or for intertwining Fairy String Lights. Create a monogram or craft a logo by attaching colorful flower garlands to the plastic grid frame. We'd recommend floral wire or wire ties as an extra measure for keeping them secure or simply staple-gun the mat to a solid surface. Create breath-taking wedding and event decor by attaching to a trellis, gazebo or pavilion. Mix materials and fashion a stunning wall of flowers and Artificial Greenery & Foliage behind a head table which can double as an elegant photo backdrop. The plastic grid frame can easily be cut if need be. This White Hydrangea Panel makes an exceptional border for other colorful wall mats like our Romantic Red Plumeria Flower Wall or mixing with textures like our Boxwood Wall Mat creates a striking visual backdrop. Budget friendly and lightweight, the design allows for many display possibilities and it works well to mask columns, walls and doors. Making over a ceiling with floral canopies is easier than ever with this awesome flower wall and for added glam, you can attach Sparkling Crystal Garlands and Pendants. Many, many ways to use this Floral Wall Mat to make your dream garden a reality! TO AVOID THE LOOK OF "SEAMS" ON A FLOWER WALL USING A PIPE AND DRAPE STRUCTURE: The most critical point is to make sure that each wall panel is secured in multiple spots, not only to the pipes but to each adjoining panel as well. The tie should be a material that won't relax or stretch like burlap twine, wire ties or zip ties. When displaying multiple panels next to each other, each wall needs to be pulled taut so the seams don't show. The flowers extend over the frame, hiding the pipes while creating a seamless look. Another key is to secure each panel to the pipe AND to the adjoining panel in at least 3 spots. You can also connect the panels by using the pegs & holes on the sides of the plastic frame. Additionally, running picture wire horizontally, vertically and diagonally on the pipe and drape structure before adding the walls allows for a firmer background to support the walls. Please view our instructional video.]]>wild-pagereddecor1https://s.yimg.com/aah/shopwildthings/flower-wall-red-pink-peach-cream-roses-hydrangeas-peony-13.jpghttps://s.yimg.com/aah/shopwildthings/flower-wall-red-pink-peach-cream-roses-hydrangeas-peony-14.jpg*flexible plastic grid frame that measures 15" x 23" but the flowers extend well over the frame making the actual measurement about 18" x 25" and it's a whopping 3" deep! The floral assortment consists of roses that are 4 1/2" in diameter, plumeria that are 5" to 6" in diameter and peonies that are 3 1/2" in diameter. Layers and layers of petals make this flower wall one of the fullest we offer and the multi-colored blooms add a ton of depth and dimension! This mat weighs 1 lb. 4 oz. and the frame is completely flexible. Two sides of the frame have plastic pegs which insert into the holes on the other two sides of the frame so you can attach as many mats as you need to cover areas small or large. The flowers extend over the edge of the mat so the grid is virtually invisible. The mat is so flexible that you can actually attach the mat to itself, creating a circular floral vase! The grids are an inch square which makes it super easy to work with for attaching the frame to another surface. We'd recommend floral wire, wire ties or heavy duty staples as an extra measure for keeping them secured. Create breath-taking wedding and event decor by attaching to a trellis or Arch. Fashion a stunning wall of flowers behind a head table which can double as an elegant photo backdrop. Use to mask or enhance a column, wall or door. If hanging from a wall or fence, use the grids to intertwine Fairy String Lights! Take a peek here at Tina's Tips & Tricks Video to see flower panels up close, how to snap them together and how they look mounted on a wall. Also please see the video below where Katie exhibits this exact wall. This mat is an ideal size to use on drop ceilings with metal grids. Create a dreamy floral canopy by suspending the mat with magnet hooks, crystal or pearl strands. Hang Sparkling Crystal Ornaments for added glam. If you need a wall that will be seen from both sides, use the easily accessible grids and tie 2 mats back-to-back. You can even cut the plastic grid frame to make creative shapes. Many, many ways to use this Floral Wall Mat to make your dream garden a reality! TO AVOID THE LOOK OF "SEAMS" ON A FLOWER WALL USING A PIPE AND DRAPE STRUCTURE: The most critical point is to make sure that each wall panel is secured in multiple spots, not only to the pipes but to each adjoining panel as well. The tie should be a material that won't relax or stretch like burlap twine, wire ties or zip ties. When displaying multiple panels next to each other, each wall needs to be pulled taut so the seams don't show. The flowers extend over the frame, hiding the pipes while creating a seamless look. Another key is to secure each panel to the pipe AND to the adjoining panel in at least 3 spots. You can also connect the panels by using the pegs & holes on the sides of the plastic frame. Additionally, running picture wire horizontally, vertically and diagonally on the pipe and drape structure before adding the walls allows for a firmer background to support the walls. ]]>wild-pageprom-homecoming-dance-decorations1https://s.yimg.com/aah/shopwildthings/flower-wall-18-x-26-premium-silk-floral-mix-soft-purples-pinks-32.jpghttps://s.yimg.com/aah/shopwildthings/flower-wall-18-x-26-premium-silk-floral-mix-soft-purples-pinks-33.jpg*The plastic frame is 15 1/2" by 23" but the flowers extend over the edges making the actual measurement about 18" by 26" and it's 3" deep! The yummy colors on the soft and silky blooms are tasteful and add just the right amount of sophistication and style to create an exciting and attractive backdrop. This wall only weighs 1.1 lb. The flowers are attached to a sturdy, plastic grid frame that is completely flexible. To connect one or more mats, insert the plastic pegs on 1 wall into the holes on the 2nd wall and so on. You can attach as many mats as you need to cover areas small or large. The flowers extend over the edge of the mat so the grid is completely hidden. The mat is so flexible that you can actually attach the mat to itself, creating a circular floral vase! The grids are an inch square which makes it super easy to work with for attaching the frame to another surface or for intertwining Fairy String Lights and many of the colors of our Plumeria Flower Garlands perfectly match this flower wall. We'd recommend floral wire or wire ties as an extra measure for keeping them secure or simply staple-gun the mat to a solid surface. Create breath-taking wedding and event decor by attaching to a trellis, gazebo or pavilion. Mix materials and fashion a stunning wall of flowers and Artificial Greenery & Foliage behind a head table which can double as an elegant photo backdrop. The plastic grid frame can easily be cut if need be. This purple, pink and cream panel also makes an exceptional border for cream or ivory floral wall mats like our Ivory Hydrangea Flower Wall or mixing with textures like our Boxwood Wall Mats creates a striking visual backdrop. Budget friendly and lightweight, the design allows for many display possibilities and it works well to mask columns, walls and doors. Making over a ceiling with floral canopies is easier than ever with this awesome flower wall and for added glam, you can attach Sparkling Crystal Garlands and Pendants. Many, many ways to use this Floral Wall Mat to make your dream garden a reality! TO AVOID THE LOOK OF "SEAMS" ON A FLOWER WALL USING A PIPE AND DRAPE STRUCTURE: The most critical point is to make sure that each wall panel is secured in multiple spots, not only to the pipes but to each adjoining panel as well. The tie should be a material that won't relax or stretch like burlap twine, wire ties or zip ties. When displaying multiple panels next to each other, each wall needs to be pulled taut so the seams don't show. The flowers extend over the frame, hiding the pipes while creating a seamless look. Another key is to secure each panel to the pipe AND to the adjoining panel in at least 3 spots. You can also connect the panels by using the pegs & holes on the sides of the plastic frame. Additionally, running picture wire horizontally, vertically and diagonally on the pipe and drape structure before adding the walls allows for a firmer background to support the walls. Please view our instructional video.]]>wild-pagefloral-walls-greenery-backdrops1https://s.yimg.com/aah/shopwildthings/silk-plumeria-frangipant-flower-wall-mat-ivory-16-x-2-58.jpghttps://s.yimg.com/aah/shopwildthings/silk-plumeria-frangipant-flower-wall-mat-ivory-16-x-2-59.jpg*The frame is 15 3/4" by 23" but the flowers extend over the edges making the actual measurement about 18" x 26" and it's 2" deep. Chocked full of the glorious Hawaiian Frangipani Flower, each soft and luscious bloom is approx. 2" wide. This mat only weighs 12 oz. which allows for many display possibilities. The flowers are attached to a sturdy, plastic grid frame that is completely flexible. Two sides of the frame have plastic pegs which insert into the holes on the other two sides of the frame so you can attach as many mats as you need to cover areas small or large. The flowers extend over the edge of the mat so the grid is pretty well hidden. The mat is so flexible that you can actually attach the mat to itself, creating a circular floral vase! The grids are an inch square which makes it super easy to work with for attaching the frame to another surface. We'd recommend floral wire or wire ties as an extra measure for keeping them secured. Create breath-taking wedding and event decor by attaching to a trellis or Arch. Fashion a stunning wall of flowers behind a head table which can double as an elegant photo backdrop. Use to mask or enhance a column, wall or door and accent with a colorful rose monogram or logo to mark the occasion! If you want to create a design with other materials you can easily part the flowers and use the grid to attach items. If hanging from a wall or fence, use the grids to intertwine fairy string lights or create dimension with your flower wall by adding beautiful Draping Blossoms. This mat is an ideal size to use on drop ceilings with metal grids. Create a dreamy floral canopy by suspending the mat with magnet hooks, crystal or pearl strands. Hang Sparkling Crystal Ornaments for added glam. If you need a wall that will be seen from both sides, use the easily accessible grids and tie 2 mats back-to-back. You can even cut the plastic grid frame to make creative shapes. Many, many ways to use this Floral Wall Mat to make your dream garden a reality! TO AVOID THE LOOK OF "SEAMS" ON A FLOWER WALL USING A PIPE AND DRAPE STRUCTURE: The most critical point is to make sure that each wall panel is secured in multiple spots, not only to the pipes but to each adjoining panel as well. The tie should be a material that won't relax or stretch like burlap twine, wire ties or zip ties. When displaying multiple panels next to each other, each wall needs to be pulled taut so the seams don't show. The flowers extend over the frame, hiding the pipes while creating a seamless look. Another key is to secure each panel to the pipe AND to the adjoining panel in at least 3 spots. You can also connect the panels by using the pegs & holes on the sides of the plastic frame. Additionally, running picture wire horizontally, vertically and diagonally on the pipe and drape structure before adding the walls allows for a firmer background to support the walls. Please view our instructional video.]]>wild-pageblackdecor11https://s.yimg.com/aah/shopwildthings/flower-wall-19-1-2-x-27-premium-silk-roses-peonies-hydrangeas-matte-black-13.jpghttps://s.yimg.com/aah/shopwildthings/flower-wall-19-1-2-x-27-premium-silk-roses-peonies-hydrangeas-matte-black-14.jpg Create your own floral paradise with this super full, Premium Quality Silk Rose, Peony & Hydrangea Flower Wall with matte black flowers that absolutely burst from this floral mat! Black is classy and goes with absolutely every color! *The flexible plastic frame is 15 1/2" by 23" but the flowers extend over the edges making the actual measurement about 19 1/2" by 27" and it ranges from 2 1/2" to 3" deep! This wall is chocked full of a luscious mix of all black flowers with pops of green leaves here and there. The roses are 4" in diameter, the peonies are 3 1/2" in diameter and the hydrangeas are 2 1/2" in diameter. This superb mix of flowers in varying textures is stunning and glamorous and you cannot see the plastic frame through this dense wall! These are so full that they can be wrapped around columns, gazebos and more! This mat only weighs 1.4 lbs. which allows for many display possibilities. The flowers are attached to a sturdy, plastic grid frame that is completely flexible. Two sides of the frame have plastic pegs which insert into the holes on the other two sides of the frame so you can attach as many mats as you need to cover areas small or large. The flowers extend over the edge of the mat so the grid is pretty well hidden. The mat is so flexible that you can actually attach the mat to itself, creating a circular floral vase! The grids are an inch square which makes it super easy to work with for attaching the frame to another surface. We'd recommend floral wire or wire ties as an extra measure for keeping them secure or simply staple-gun it to a solid surface. Create breath-taking wedding and event decor by attaching to a trellis, plywood or heavy wire structure. Fashion a stunning wall of flowers as a backdrop behind a head table which can double as an elegant photo backdrop. Use to mask or enhance a column, wall or door and easily add Fairy String Lights to add even more dimension. This mat is an ideal size to use on drop ceilings with metal grids. Create a dreamy floral canopy by suspending the mat with magnet hooks. Intertwine Sparkling Crystal Strands for added glam or add playful butterfly garlands! If you need a wall that will be seen from both sides, use the easily accessible grids and tie 2 mats back-to-back. You can even cut the plastic grid frame to make creative shapes. Many, many ways to use this Floral Wall Mat to make your dream garden a reality! TO AVOID THE LOOK OF "SEAMS" ON A FLOWER WALL USING A PIPE AND DRAPE STRUCTURE: The most critical point is to make sure that each wall panel is secured in multiple spots, not only to the pipes but to each adjoining panel as well. The tie should be a material that won't relax or stretch like burlap twine, wire ties or zip ties. When displaying multiple panels next to each other, each wall needs to be pulled taut so the seams don't show. The flowers extend over the frame, hiding the pipes while creating a seamless look. Another key is to secure each panel to the pipe AND to the adjoining panel in at least 3 spots. You can also connect the panels by using the pegs & holes on the sides of the plastic frame. Additionally, running picture wire horizontally, vertically and diagonally on the pipe and drape structure before adding the walls allows for a firmer background to support the walls. Please view our Instructional Video on how to build a flower wall.]]>wild-pagewhclde1https://s.yimg.com/aah/shopwildthings/flower-wall-19-1-2-x-27-premium-silk-roses-peonies-hydrangeas-white-86.jpghttps://s.yimg.com/aah/shopwildthings/flower-wall-19-1-2-x-27-premium-silk-roses-peonies-hydrangeas-white-87.jpg These are so full that they can be wrapped around columns, gazebos and more! Create your own floral paradise with this super full, Premium Quality Silk Rose, Peony & Hydrangea Flower Wall with pure white flowers that absolutely burst from this floral mat! *The flexible plastic frame is 15 1/2" by 23" but the flowers extend over the edges making the actual measurement about 19 1/2" by 27" and it ranges from 2 1/2" to 3" deep! This wall is chocked full of a luscious mix of snow white flowers: roses that are 4" in diameter, peonies that are 3 1/2" in diameter and hydrangeas that are 2 1/2" in diameter. This superb mix of flowers in varying textures is stunning and glamorous and you cannot see the plastic frame through this dense wall! This mat only weighs about 1 lb. 6 oz. which allows for many display possibilities. The flowers are attached to a sturdy, plastic grid frame that is completely flexible and very durable. Two sides of the frame have plastic pegs which insert into the holes on the other two sides of the frame so you can attach as many mats as you need to cover areas small or large. The flowers extend over the edge of the mat and the grid is totally hidden. The mat is so flexible that you can actually attach the mat to itself, creating a circular floral vase! The grids are an inch square which makes it super easy to work with for attaching the frame to another surface. We'd recommend floral wire or wire ties as an extra measure for keeping them secure or simply staple-gun it to a solid surface. Create breath-taking wedding and event Decor by attaching to a trellis, gazebo or pavilion. Fashion a stunning wall of flowers with a border of Landscape Wall Greenery behind a head table which can then double as an elegant photo backdrop. Use to mask or enhance a column, wall or door and accent with a monogram or logo to mark the occasion! This wall creates a focal point all by itself but you could also add lights by intertwining fairy string lights or add exotic Butterfly Garlands. This mat is an ideal size to use on drop ceilings with metal grids. Create a dreamy floral canopy by suspending the mat with magnet hooks, crystal or pearl strands. Hang Sparkling Crystal Pendants & Ornaments for added glam. If you need a wall that will be seen from both sides, use the easily accessible grids and tie 2 mats back-to-back. You can even cut the plastic grid frame to make creative shapes. Many, many ways to use this Floral Wall Mat to make your dream garden a reality! TO AVOID THE LOOK OF "SEAMS" ON A FLOWER WALL USING A PIPE AND DRAPE STRUCTURE: The most critical point is to make sure that each wall panel is secured in multiple spots, not only to the pipes but to each adjoining panel as well. The tie should be a material that won't relax or stretch like burlap twine, wire ties or zip ties. When displaying multiple panels next to each other, each wall needs to be pulled taut so the seams don't show. The flowers extend over the frame, hiding the pipes while creating a seamless look. Another key is to secure each panel to the pipe AND to the adjoining panel in at least 3 spots. You can also connect the panels by using the pegs & holes on the sides of the plastic frame. Additionally, running picture wire horizontally, vertically and diagonally on the pipe and drape structure before adding the walls allows for a firmer background to support the walls. Please view our instructional video.]]>wild-pagefloral-walls-greenery-backdrops1https://s.yimg.com/aah/shopwildthings/flower-walls-pink-shopwildthings-61.jpghttps://s.yimg.com/aah/shopwildthings/flower-walls-pink-shopwildthings-62.jpg*The frame is 15 3/4" by 23" but the flowers extend over the edges making the actual measurement about 19" x 25 1/2" and it ranges from 2" to 3" deep! This wall is chocked full of a luscious mix of glorious Soft Pink Roses that are 4" in diameter and splendid Soft Pink Hydrangeas that are approx. 2" in diameter. The roses are cupped into green leaves, giving a nice contrast and added texture. This mat only weighs about 1 lb. 6 oz. which allows for many display possibilities. The flowers are attached to a sturdy, plastic grid frame that is completely flexible. Two sides of the frame have plastic pegs which insert into the holes on the other two sides of the frame so you can attach as many mats as you need to cover areas small or large. The flowers extend over the edge of the mat so the grid is pretty well hidden. The mat is so flexible that you can actually attach the mat to itself, creating a circular floral vase! The grids are an inch square which makes it super easy to work with for attaching the frame to another surface. We'd recommend floral wire or wire ties as an extra measure for keeping them secure or simply staple-gun it to a solid surface. Create breath-taking wedding and event Decor by attaching to a trellis, gazebo or pavilion. Fashion a stunning wall of flowers and Landscape Wall Greenery behind a head table which can double as an elegant photo backdrop. Use to mask or enhance a column, wall or door and accent with a colorful rose monogram or logo to mark the occasion! If you want to create a design with other materials you can easily part the flowers and use the grid to attach items. Intertwine fairy string lights or create dimension with your flower wall by intertwining Crystal Beaded Flower Garlands! This mat is an ideal size to use on drop ceilings with metal grids. Create a dreamy floral canopy by suspending the mat with magnet hooks, crystal or pearl strands. Add Sparkling Crystal Strands for added glam. If you need a wall that will be seen from both sides, use the easily accessible grids and tie 2 mats back-to-back. You can even cut the plastic grid frame to make creative shapes. Many, many ways to use this Floral Wall Mat to make your dream garden a reality! TO AVOID THE LOOK OF "SEAMS" ON A FLOWER WALL USING A PIPE AND DRAPE STRUCTURE: The most critical point is to make sure that each wall panel is secured in multiple spots, not only to the pipes but to each adjoining panel as well. The tie should be a material that won't relax or stretch like burlap twine, wire ties or zip ties. When displaying multiple panels next to each other, each wall needs to be pulled taut so the seams don't show. The flowers extend over the frame, hiding the pipes while creating a seamless look. Another key is to secure each panel to the pipe AND to the adjoining panel in at least 3 spots. You can also connect the panels by using the pegs & holes on the sides of the plastic frame. Additionally, running picture wire horizontally, vertically and diagonally on the pipe and drape structure before adding the walls allows for a firmer background to support the walls. Please view our instructional video.]]>wild-pagefloral-walls-greenery-backdrops1https://s.yimg.com/aah/shopwildthings/flower-wall-19-x-27-silk-roses-hydrangeas-blush-pink-ivory-38.jpghttps://s.yimg.com/aah/shopwildthings/flower-wall-19-x-27-silk-roses-hydrangeas-blush-pink-ivory-39.jpg*The frame is 15 3/4" by 23" but the flowers extend over the edges making the actual measurement about 19" x 25 1/2" and it ranges from 2" to 3" deep! This wall is chocked full of a luscious mix of glorious Soft Pink Roses that are 4" in diameter and splendid Ivory Hydrangeas that are approx. 2" in diameter. The roses are cupped into green leaves, giving a nice contrast and added texture. This mat only weighs about 1 lb. 6 oz. which allows for many display possibilities. The flowers are attached to a sturdy, plastic grid frame that is completely flexible. Two sides of the frame have plastic pegs which insert into the holes on the other two sides of the frame so you can attach as many mats as you need to cover areas small or large. The flowers extend over the edge of the mat so the grid is pretty well hidden. The mat is so flexible that you can actually attach the mat to itself, creating a circular floral vase! The grids are an inch square which makes it super easy to work with for attaching the frame to another surface. We'd recommend floral wire or wire ties as an extra measure for keeping them secure or simply staple-gun it to a solid surface. Create breath-taking wedding and event Decor by attaching to a trellis, gazebo or pavilion. Fashion a stunning wall of flowers and Landscape Wall Greenery behind a head table which can double as an elegant photo backdrop. Use to mask or enhance a column, wall or door and accent with a colorful rose monogram or logo to mark the occasion! If you want to create a design with other materials you can easily part the flowers and use the grid to attach items. Intertwine fairy string lights or create dimension with your flower wall by intertwining a Crystal Beaded Flower Garlands! This mat is an ideal size to use on drop ceilings with metal grids. Create a dreamy floral canopy by suspending the mat with magnet hooks, crystal or pearl strands. Add Sparkling Crystal Strands for added glam. If you need a wall that will be seen from both sides, use the easily accessible grids and tie 2 mats back-to-back. You can even cut the plastic grid frame to make creative shapes. Many, many ways to use this Floral Wall Mat to make your dream garden a reality! TO AVOID THE LOOK OF "SEAMS" ON A FLOWER WALL USING A PIPE AND DRAPE STRUCTURE: The most critical point is to make sure that each wall panel is secured in multiple spots, not only to the pipes but to each adjoining panel as well. The tie should be a material that won't relax or stretch like burlap twine, wire ties or zip ties. When displaying multiple panels next to each other, each wall needs to be pulled taut so the seams don't show. The flowers extend over the frame, hiding the pipes while creating a seamless look. Another key is to secure each panel to the pipe AND to the adjoining panel in at least 3 spots. You can also connect the panels by using the pegs & holes on the sides of the plastic frame. Additionally, running picture wire horizontally, vertically and diagonally on the pipe and drape structure before adding the walls allows for a firmer background to support the walls. Please view our instructional video.]]>wild-pagestand-alone-flower-wall-backdrop-video-tutorial1https://s.yimg.com/aah/shopwildthings/white-flower-walls-shopwildthings-38.jpghttps://s.yimg.com/aah/shopwildthings/white-flower-walls-shopwildthings-39.jpg So full that they can be WRAPPED around your design pieces! Ever dream of walking into a flower garden that literally engulfs you in gorgeous flowers? Now you can create your own floral paradise with our durable, bendable White Silk Flower Rose and Hydrangea Mix Wall Mat and immerse yourself and your guests in tropical floral bliss! *The frame is 15 3/4" by 23" but the flowers extend over the edges making the actual measurement about 19" x 25 1/2" and it ranges from 2" to 3" deep! This wall is chocked full of a luscious mix of glorious White Roses that are 4" in diameter and splendid White Hydrangeas that are approx. 2" in diameter. The roses are cupped into green leaves, giving a nice contrast and added texture. This mat only weighs about 1 lb. 6 oz. which allows for many display possibilities. The flowers are attached to a sturdy, plastic grid frame that is completely flexible. Two sides of the frame have plastic pegs which insert into the holes on the other two sides of the frame so you can attach as many mats as you need to cover areas small or large. The flowers extend over the edge of the mat so the grid is pretty well hidden. The mat is so flexible that you can actually attach the mat to itself, creating a circular floral vase! The grids are an inch square which makes it super easy to work with for attaching the frame to another surface. We'd recommend floral wire or wire ties as an extra measure for keeping them secure or simply staple-gun it to a solid surface. Create breath-taking wedding and event Decor by attaching to a trellis, gazebo or pavilion. Fashion a stunning wall of flowers and Landscape Wall Greenery behind a head table which can double as an elegant photo backdrop. Use to mask or enhance a column, wall or door and accent with a colorful rose monogram or logo to mark the occasion! If you want to create a design with other materials you can easily part the flowers and use the grid to attach items. Intertwine fairy string lights or create dimension with your flower wall by adding beautiful and exotic Draping Blossoms! This mat is an ideal size to use on drop ceilings with metal grids. Create a dreamy floral canopy by suspending the mat with magnet hooks, crystal or pearl strands. Hang Sparkling Crystal Pendants & Ornaments for added glam. If you need a wall that will be seen from both sides, use the easily accessible grids and tie 2 mats back-to-back. You can even cut the plastic grid frame to make creative shapes. Many, many ways to use this Floral Wall Mat to make your dream garden a reality! TO AVOID THE LOOK OF SEAMS ON A FLOWER WALL USING A PIPE AND DRAPE STRUCTURE: The most critical point is to make sure that each wall panel is secured in multiple spots, not only to the pipes but to each adjoining panel as well. The tie should be a material that won't relax or stretch like burlap twine, wire ties or zip ties. When displaying multiple panels next to each other, each wall needs to be pulled taut so the seams don't show. The flowers extend over the frame, hiding the pipes while creating a seamless look. Another key is to secure each panel to the pipe AND to the adjoining panel in at least 3 spots. You can also connect the panels by using the pegs & holes on the sides of the plastic frame. Additionally, running picture wire horizontally, vertically and diagonally on the pipe and drape structure before adding the walls allows for a firmer background to support the walls. Please view our instructional video.]]>wild-pagepinks11https://s.yimg.com/aah/shopwildthings/blush-pink-artificial-rose-landscape-walls-13.jpghttps://s.yimg.com/aah/shopwildthings/blush-pink-artificial-rose-landscape-walls-14.jpg Create your own floral paradise with our durable, bendable Pink Silk Rose and Leafy Green Flower Wall Mat and immerse yourself and your guests in tropical floral bliss! *The frame is 15 1/2" by 23" but the flowers extend over the edges making the actual measurement about 19" x 25". The majority of the roses are a luscious 3" – 4" wide by 3" deep with several younger rose sprigs popping up to approx. 4". The flowers sit above the dark green leaves, making this a very textured and dimensional wall, like an actual growing wall of roses! This mat only weighs 15 oz. which allows for many display possibilities. The flowers are attached to a sturdy, plastic grid frame that is completely flexible. Two sides of the frame have plastic pegs which insert into the holes on the other two sides of the frame so you can attach as many mats as you need to cover areas small or large. The flowers extend over the edge of the mat so the grid is pretty well hidden. The mat is so flexible that you can actually attach the mat to itself, creating a circular floral vase! The grids are an inch square which makes it super easy to work with for attaching the frame to another surface. We'd recommend floral wire or wire ties as an extra measure for keeping them secure or simply staple-gun it to a solid surface. Create breath-taking wedding and event decor by attaching to a trellis, plywood or heavy wire structure. Fashion a stunning wall of flowers as a backdrop behind a head table which can double as an elegant photo backdrop. Use to mask or enhance a column, wall or door and easily add Fairy String Lights to add even more dimension. This mat is an ideal size to use on drop ceilings with metal grids. Attach to "Victory", our portable flower wall frame stands which can sit on tables or remove the legs to mount them on a wall. Create a dreamy floral canopy by suspending the mat with magnet hooks. Intertwine Sparkling Crystal Strands for added glam or add playful butterfly garlands! If you need a wall that will be seen from both sides, use the easily accessible grids and tie 2 mats back-to-back. You can even cut the plastic grid frame to make creative shapes. Many, many ways to use this Floral Wall Mat to make your dream garden a reality! TO AVOID THE LOOK OF "SEAMS" ON A FLOWER WALL USING A PIPE AND DRAPE STRUCTURE: The most critical point is to make sure that each wall panel is secured in multiple spots, not only to the pipes but to each adjoining panel as well. The tie should be a material that won't relax or stretch like burlap twine, wire ties or zip ties. When displaying multiple panels next to each other, each wall needs to be pulled taut so the seams don't show. The flowers extend over the frame, hiding the pipes while creating a seamless look. Another key is to secure each panel to the pipe AND to the adjoining panel in at least 3 spots. You can also connect the panels by using the pegs & holes on the sides of the plastic frame. Additionally, running picture wire horizontally, vertically and diagonally on the pipe and drape structure before adding the walls allows for a firmer background to support the walls. Please view our Instructional Video on how to build a flower wall.]]>wild-pagereddecor11https://s.yimg.com/aah/shopwildthings/red-roses-flower-wall-with-greenery-13.jpghttps://s.yimg.com/aah/shopwildthings/red-roses-flower-wall-with-greenery-14.jpg Create your own floral paradise with our durable, bendable Red Silk Rose and Leafy Green Flower Wall Mat and immerse yourself and your guests in tropical floral bliss! *The frame is 15 1/2" by 23" but the flowers extend over the edges making the actual measurement about 19" x 25". The roses have tinges of garnet red on the petal edges and the majority are a luscious 3" – 4" wide by 3" deep with several younger rose sprigs popping up to approx. 4". The flowers sit above the dark green leaves, making this a very textured and dimensional wall, like an actual growing wall of roses! This mat only weighs 15 oz. which allows for many display possibilities. The flowers are attached to a sturdy, plastic grid frame that is completely flexible. Two sides of the frame have plastic pegs which insert into the holes on the other two sides of the frame so you can attach as many mats as you need to cover areas small or large. The flowers extend over the edge of the mat so the grid is pretty well hidden. The mat is so flexible that you can actually attach the mat to itself, creating a circular floral vase! The grids are an inch square which makes it super easy to work with for attaching the frame to another surface. We'd recommend floral wire or wire ties as an extra measure for keeping them secure or simply staple-gun it to a solid surface. Create breath-taking wedding and event decor by attaching to a trellis, plywood or heavy wire structure. Fashion a stunning wall of flowers as a backdrop behind a head table which can double as an elegant photo backdrop. Use to mask or enhance a column, wall or door and easily add Fairy String Lights to add even more dimension. This mat is an ideal size to use on drop ceilings with metal grids. Attach to "Victory", our portable flower wall frame stands which can sit on tables or remove the legs to mount them on a wall. Create a dreamy floral canopy by suspending the mat with magnet hooks. Intertwine Sparkling Crystal Strands for added glam or add playful butterfly garlands! If you need a wall that will be seen from both sides, use the easily accessible grids and tie 2 mats back-to-back. You can even cut the plastic grid frame to make creative shapes. Many, many ways to use this Floral Wall Mat to make your dream garden a reality! TO AVOID THE LOOK OF "SEAMS" ON A FLOWER WALL USING A PIPE AND DRAPE STRUCTURE: The most critical point is to make sure that each wall panel is secured in multiple spots, not only to the pipes but to each adjoining panel as well. The tie should be a material that won't relax or stretch like burlap twine, wire ties or zip ties. When displaying multiple panels next to each other, each wall needs to be pulled taut so the seams don't show. The flowers extend over the frame, hiding the pipes while creating a seamless look. Another key is to secure each panel to the pipe AND to the adjoining panel in at least 3 spots. You can also connect the panels by using the pegs & holes on the sides of the plastic frame. Additionally, running picture wire horizontally, vertically and diagonally on the pipe and drape structure before adding the walls allows for a firmer background to support the walls. Please view our Instructional Video on how to build a flower wall.]]>wild-pagebrandnewitems1https://s.yimg.com/aah/shopwildthings/artificial-flower-wall-backdrop-coral-pink-27.jpghttps://s.yimg.com/aah/shopwildthings/artificial-flower-wall-backdrop-coral-pink-28.jpgEXTRA FULL! These are so full that they can be wrapped around columns, gazebos and more! Create your own floral paradise with our durable, bendable Premium Quality Silk Hydrangea Coral Pink Flower Wall Mat and immerse yourself and your guests in tropical floral bliss! *The flexible plastic frame is 15 1/2" by 23" but the flowers extend over the edges making the actual measurement about 19" x 26 1/2" and it's 2 1/2" deep. Chocked full of splendid Hydrangea flowers, each soft and luscious bloom is approx. 2 1/2" wide. This mat only weighs 14 oz. which allows for many display possibilities. The flowers are attached to a sturdy, plastic grid frame that is completely flexible. Two sides of the frame have plastic pegs which insert into the holes on the other two sides of the frame so you can attach as many mats as you need to cover areas small or large. The flowers are dense and extend over the edge of the mat so the grid is hidden. The mat is so flexible that you can actually attach the mat to itself, creating a circular floral vase! The grids are an inch square which makes it super easy to work with for attaching the frame to another surface. We'd recommend floral wire or wire ties as an extra measure for keeping them secure or simply staple-gun it to a solid surface. Create breath-taking wedding and event Decor by attaching to a trellis, gazebo or pavilion. Fashion a stunning wall of flowers with a border of Landscape Wall Greenery behind a head table which can then double as an elegant photo backdrop. Use to mask or enhance a column, wall or door and accent with white artificial roses to create a monogram or logo to mark the occasion! This wall creates a focal point all by itself but you could also add lights by intertwining fairy string lights or add exotic Butterfly Garlands. This mat is an ideal size to use on drop ceilings with metal grids. Create a dreamy floral canopy by suspending the mat with magnet hooks, crystal or pearl strands. Hang Sparkling Crystal Pendants & Ornaments for added glam. If you need a wall that will be seen from both sides, use the easily accessible grids and tie 2 mats back-to-back. You can even cut the plastic grid frame to make creative shapes. Many, many ways to use this Floral Wall Mat to make your dream garden a reality! TO AVOID THE LOOK OF "SEAMS" ON A FLOWER WALL USING A PIPE AND DRAPE STRUCTURE: The most critical point is to make sure that each wall panel is secured in multiple spots, not only to the pipes but to each adjoining panel as well. The tie should be a material that won't relax or stretch like burlap twine, wire ties or zip ties. When displaying multiple panels next to each other, each wall needs to be pulled taut so the seams don't show. The flowers extend over the frame, hiding the pipes while creating a seamless look. Another key is to secure each panel to the pipe AND to the adjoining panel in at least 3 spots. You can also connect the panels by using the pegs & holes on the sides of the plastic frame. Additionally, running picture wire horizontally, vertically and diagonally on the pipe and drape structure before adding the walls allows for a firmer background to support the walls. Please view our instructional video.]]>wild-pagewhclde11https://s.yimg.com/aah/shopwildthings/roses-and-leaves-flower-wall-ivory-cream-31.jpghttps://s.yimg.com/aah/shopwildthings/roses-and-leaves-flower-wall-ivory-cream-32.jpg Create your own floral paradise with our durable, bendable Cream Silk Rose and Leafy Green Flower Wall Mat and immerse yourself and your guests in tropical floral bliss! *The frame is 15 1/2" by 23" but the flowers extend over the edges making the actual measurement about 19" x 26". The majority of the roses are a luscious 3" – 4" wide by 3" deep with several younger rose sprigs popping up to approx. 4". The flowers sit above the dark green leaves, making this a very textured and dimensional wall, like an actual growing wall of roses! This mat only weighs 15 oz. which allows for many display possibilities. The flowers are attached to a sturdy, plastic grid frame that is completely flexible. Two sides of the frame have plastic pegs which insert into the holes on the other two sides of the frame so you can attach as many mats as you need to cover areas small or large. The flowers extend over the edge of the mat so the grid is pretty well hidden. The mat is so flexible that you can actually attach the mat to itself, creating a circular floral vase! The grids are an inch square which makes it super easy to work with for attaching the frame to another surface. We'd recommend floral wire or wire ties as an extra measure for keeping them secure or simply staple-gun it to a solid surface. Create breath-taking wedding and event decor by attaching to a trellis, plywood or heavy wire structure. Fashion a stunning wall of flowers as a backdrop behind a head table which can double as an elegant photo backdrop. Use to mask or enhance a column, wall or door and easily add Fairy String Lights to add even more dimension. This mat is an ideal size to use on drop ceilings with metal grids. Create a dreamy floral canopy by suspending the mat with magnet hooks. Intertwine Sparkling Crystal Strands for added glam or add playful butterfly garlands! If you need a wall that will be seen from both sides, use the easily accessible grids and tie 2 mats back-to-back. You can even cut the plastic grid frame to make creative shapes. Many, many ways to use this Floral Wall Mat to make your dream garden a reality! TO AVOID THE LOOK OF "SEAMS" ON A FLOWER WALL USING A PIPE AND DRAPE STRUCTURE: The most critical point is to make sure that each wall panel is secured in multiple spots, not only to the pipes but to each adjoining panel as well. The tie should be a material that won't relax or stretch like burlap twine, wire ties or zip ties. When displaying multiple panels next to each other, each wall needs to be pulled taut so the seams don't show. The flowers extend over the frame, hiding the pipes while creating a seamless look. Another key is to secure each panel to the pipe AND to the adjoining panel in at least 3 spots. You can also connect the panels by using the pegs & holes on the sides of the plastic frame. Additionally, running picture wire horizontally, vertically and diagonally on the pipe and drape structure before adding the walls allows for a firmer background to support the walls. Please view our Instructional Video on how to build a flower wall.]]>wild-pagewhclde11https://s.yimg.com/aah/shopwildthings/greenery-backdrop-with-white-roses-13.jpghttps://s.yimg.com/aah/shopwildthings/greenery-backdrop-with-white-roses-14.jpg Create your own floral paradise with our durable, bendable White Silk Rose and Leafy Green Flower Wall Mat and immerse yourself and your guests in tropical floral bliss! *The frame is 15 1/2" by 23" but the flowers extend over the edges making the actual measurement about 19" x 26". The majority of the roses are a luscious 3" – 4" wide by 3" deep with several younger rose sprigs popping up to approx. 4". The flowers sit above the dark green leaves, making this a very textured and dimensional wall, like an actual growing wall of roses! This mat only weighs 15 oz. which allows for many display possibilities. The flowers are attached to a sturdy, plastic grid frame that is completely flexible. Two sides of the frame have plastic pegs which insert into the holes on the other two sides of the frame so you can attach as many mats as you need to cover areas small or large. The flowers extend over the edge of the mat so the grid is pretty well hidden. The mat is so flexible that you can actually attach the mat to itself, creating a circular floral vase! The grids are an inch square which makes it super easy to work with for attaching the frame to another surface. We'd recommend floral wire or wire ties as an extra measure for keeping them secure or simply staple-gun it to a solid surface. Create breath-taking wedding and event decor by attaching to a trellis, plywood or heavy wire structure. Fashion a stunning wall of flowers as a backdrop behind a head table which can double as an elegant photo backdrop. Use to mask or enhance a column, wall or door and easily add Fairy String Lights to add even more dimension. This mat is an ideal size to use on drop ceilings with metal grids. Create a dreamy floral canopy by suspending the mat with magnet hooks. Intertwine Sparkling Crystal Strands for added glam or add playful butterfly garlands! If you need a wall that will be seen from both sides, use the easily accessible grids and tie 2 mats back-to-back. You can even cut the plastic grid frame to make creative shapes. Many, many ways to use this Floral Wall Mat to make your dream garden a reality! TO AVOID THE LOOK OF "SEAMS" ON A FLOWER WALL USING A PIPE AND DRAPE STRUCTURE: The most critical point is to make sure that each wall panel is secured in multiple spots, not only to the pipes but to each adjoining panel as well. The tie should be a material that won't relax or stretch like burlap twine, wire ties or zip ties. When displaying multiple panels next to each other, each wall needs to be pulled taut so the seams don't show. The flowers extend over the frame, hiding the pipes while creating a seamless look. Another key is to secure each panel to the pipe AND to the adjoining panel in at least 3 spots. You can also connect the panels by using the pegs & holes on the sides of the plastic frame. Additionally, running picture wire horizontally, vertically and diagonally on the pipe and drape structure before adding the walls allows for a firmer background to support the walls. Please view our Instructional Video on how to build a flower wall.]]>wild-pagepurplestuff11https://s.yimg.com/aah/shopwildthings/flower-wall-19-x-27-premium-silk-roses-hydrangeas-purple-35.jpghttps://s.yimg.com/aah/shopwildthings/flower-wall-19-x-27-premium-silk-roses-hydrangeas-purple-36.jpg Ever dream of walking into a flower garden that literally engulfs you in gorgeous flowers? Now you can create your own floral paradise with our durable, bendable Purple Silk Flower Rose and Hydrangea Mix Wall Mat and immerse yourself and your guests in tropical floral bliss! *The frame is 15 1/2" by 23" but the flowers extend over the edges making the actual measurement about 19" x 27" and it ranges from 2 1/2" to 3" deep! This wall is chocked full of a luscious mix of beautiful purple roses that are 4" in diameter and splendid purple hydrangeas that are approx. 2" in diameter with white seeds. The roses are cupped into green leaves, giving a nice contrast and added texture. This mat only weighs about 1 lb. 6 oz. which allows for many display possibilities. The flowers are attached to a sturdy, plastic grid frame that is completely flexible. Two sides of the frame have plastic pegs which insert into the holes on the other two sides of the frame so you can attach as many mats as you need to cover areas small or large. The flowers extend over the edge of the mat so the grid is completely hidden. The mat is so flexible that you can actually attach the mat to itself, creating a circular floral vase! The grids are an inch square which makes it super easy to work with for attaching the frame to another surface. Attach to "Victory", our portable flower wall frame stands which can sit on tables or, remove the legs to mount them on a wall. We'd recommend floral wire or wire ties as an extra measure for keeping them secure or simply staple-gun it to a solid surface. Create breath-taking wedding and event decor by attaching to a trellis, gazebo or pavilion. Fashion a stunning wall of flowers outlined with Assorted Greenery behind a head table which can double as an elegant photo backdrop. Use to mask or enhance a column, wall or door and accent with a colorful rose monogram or logo to mark the occasion! If you want to create a design with other materials you can easily part the flowers and use the grid to attach items. Intertwine fairy string lights and this mat is an ideal size to use on drop ceilings with metal grids. Create a dreamy floral canopy by suspending the mat with magnet hooks, crystal or pearl strands. Intertwine Sparkling Crystal Strands for added glam. If you need a wall that will be seen from both sides, use the easily accessible grids and tie 2 mats back-to-back. You can even cut the plastic grid frame to make creative shapes. Many, many ways to use this Floral Wall Mat to make your dream garden a reality! TO AVOID THE LOOK OF "SEAMS" ON A FLOWER WALL USING A PIPE AND DRAPE STRUCTURE: The most critical point is to make sure that each wall panel is secured in multiple spots, not only to the pipes but to each adjoining panel as well. The tie should be a material that won't relax or stretch like burlap twine, wire ties or zip ties. When displaying multiple panels next to each other, each wall needs to be pulled taut so the seams don't show. The flowers extend over the frame, hiding the pipes while creating a seamless look. Another key is to secure each panel to the pipe AND to the adjoining panel in at least 3 spots. You can also connect the panels by using the pegs & holes on the sides of the plastic frame. Additionally, running picture wire horizontally, vertically and diagonally on the pipe and drape structure before adding the walls allows for a firmer background to support the walls. Please view our instructional video.]]>wild-pagefloral-walls-greenery-backdrops1https://s.yimg.com/aah/shopwildthings/flower-walls-pink-roses-cream-ivory-30.jpghttps://s.yimg.com/aah/shopwildthings/flower-walls-pink-roses-cream-ivory-31.jpg Make sure to check out the two videos! Ever dream of walking into a flower garden that literally engulfs you in gorgeous flowers? Now you can create your own floral paradise with our durable, bendable Blush Pink and Ivory Silk Flower Rose and Hydrangea Mix Wall Mat and immerse yourself and your guests in tropical floral bliss! *The frame is 15 1/2" by 23" but the flowers extend over the edges making the actual measurement about 20" x 27" and it is 3" deep! This wall is chocked full of a luscious mix of glorious Soft Pink Roses that are 4" in diameter and large clumps of Ivory Hydrangea blooms that are approx. 2 1/2" in diameter. The roses are cupped into green leaves, giving a nice contrast and added texture. This mat only weighs about 1 lb. 3 oz. which allows for many display possibilities. The flowers are attached to a sturdy, plastic grid frame that is completely flexible. Two sides of the frame have plastic pegs which insert into the holes on the other two sides of the frame so you can attach as many mats as you need to cover areas small or large. The flowers extend over the edge of the mat so the grid is pretty well hidden. The mat is so flexible that you can actually attach the mat to itself, creating a circular floral vase! The grids are an inch square which makes it super easy to work with for attaching the frame to another surface. We'd recommend floral wire or wire ties as an extra measure for keeping them secure or simply staple-gun it to a solid surface. Create breath-taking wedding and event Decor by attaching to a trellis, gazebo or pavilion. Fashion a stunning wall of flowers and Landscape Wall Greenery behind a head table which can double as an elegant photo backdrop. Use to mask or enhance a column, wall or door and accent with a colorful rose monogram or logo to mark the occasion! If you want to create a design with other materials you can easily part the flowers and use the grid to attach items. Intertwine fairy string lights or create dimension with your flower wall by intertwining Crystal Beaded Flower Garlands! This mat is an ideal size to use on drop ceilings with metal grids. Create a dreamy floral canopy by suspending the mat with magnet hooks, crystal or pearl strands. Add Sparkling Crystal Strands for added glam. If you need a wall that will be seen from both sides, use the easily accessible grids and tie 2 mats back-to-back. You can even cut the plastic grid frame to make creative shapes. Many, many ways to use this Floral Wall Mat to make your dream garden a reality! TO AVOID THE LOOK OF "SEAMS" ON A FLOWER WALL USING A PIPE AND DRAPE STRUCTURE: The most critical point is to make sure that each wall panel is secured in multiple spots, not only to the pipes but to each adjoining panel as well. The tie should be a material that won't relax or stretch like burlap twine, wire ties or zip ties. When displaying multiple panels next to each other, each wall needs to be pulled taut so the seams don't show. The flowers extend over the frame, hiding the pipes while creating a seamless look. Another key is to secure each panel to the pipe AND to the adjoining panel in at least 3 spots. You can also connect the panels by using the pegs & holes on the sides of the plastic frame. Additionally, running picture wire horizontally, vertically and diagonally on the pipe and drape structure before adding the walls allows for a firmer background to support the walls. Please view our instructional video.]]>wild-page11https://s.yimg.com/aah/shopwildthings/flower-wall-backdrop-stand-tutorial-victory-white-metal-frame-set-of-4-15.jpghttps://s.yimg.com/aah/shopwildthings/flower-wall-backdrop-stand-tutorial-victory-white-metal-frame-set-of-4-16.jpgIt can be tough to figure out what to hang your Flower Wall Panels and Greenery Landscape Walls on in order to display them for your weddings and events. In this video, we answer the questions you have about how to use our new "Victory" White Metal Backdrop Stand and different ideas on how to place them. wild-pagewhclde11https://s.yimg.com/aah/shopwildthings/flower-wall-curved-section-silk-flowers-14.jpghttps://s.yimg.com/aah/shopwildthings/flower-wall-curved-section-silk-flowers-15.jpg*The plastic frame on this curved flower wall measures 4 3/4" x 17" but the flowers extend well over the edges making the actual measurement about 9 1/2" x 19". This wall section features 4" wide roses cupped in green leaves and 2" wide hydrangeas mounted on a heavy-duty green plastic grid that is a 120° arc. These walls are the answer to covering wedding arches, the poles on pipe and drape kits, chupphas, gazebos or the support columns found in many venue halls. Both of the 17" long sides of the mat have 3 holes, each 3/8" in diameter. You can use these sturdy holes to fasten (wire ties or fabric floral wire, for example) together as many mats as you need. No matter how large the column, pole or surface is, the slightly curved design will envelope your structure in magnificent flowers which extend well over the frame edge to hide the connecting ties. For indoor and outdoor events, Wedding Arches provide the perfect setting to frame the ceremony and are an awesome backdrop for pictures. The amount of mats needed will depend on the depth of the arch (front to back measurement). For example, on our Seraphina and Amore Arches which are each 5" deep, if only the foremost part of the arch will be seen, 2 mats would suffice but if you want a fully covered arch, we recommend using 3 mats around the frame. This gives a very full look with complete coverage from any angle. If you're using a Pipe and Drape Backdrop Kit or Gazebo , you only need 2 mats, tied back to back, to fit around a pole up to 2" in diameter. If using a backdrop kit that will be positioned against a wall, just use 1 mat (tying it to itself) to cover the front of the pole. It takes 4 mats to cover 1 side of a 6' tall pole. A lot of indoor venues have support columns or poles that notoriously look a bit shabby and isn't it true that the more outstanding a room looks, the more our eyes tend to zero in on those unattractive areas (ah, human nature!). The curved design on these mats is such that no matter how large the column or pole, it can be covered by fastening additional mats together. Perhaps you have a narrow wall or surface that's too small for a regular sized flower wall or you'd like to create a border on an existing flower wall. This curved mat will add the finishing detail and enhance the look. It perfectly matches our Blush Pink & Ivory Flower Wall and our Cream Flower Wall. After you've checked every detail of your well planned, impressive venue, check again. Those overlooked areas might just need some TLC to perfect the look!]]>wild-pagefloral-walls-greenery-backdrops1https://s.yimg.com/aah/shopwildthings/flower-wall-16-x-24-silk-hydrangeas-pink-28.jpghttps://s.yimg.com/aah/shopwildthings/flower-wall-16-x-24-silk-hydrangeas-pink-29.jpg*The frame on this durable, bendable mat is 15 1/2" x 23" but the flowers extend over the edges making the actual measurement about 17" x 24" and it's 1 1/2" deep. Chocked full of the glorious Hawaiian Frangipani Flower, each soft and luscious bloom is approx. 2" wide. Create your own floral paradise by immersing your guests in tropical floral bliss! This mat only weighs 12 oz. which allows for many display possibilities. The flowers are attached to a sturdy, plastic grid frame that is completely flexible. Two sides of the frame have plastic pegs which insert into the holes on the other two sides of the frame so you can attach as many mats as you need to cover areas small or large. The flowers extend over the edge of the mat so the grid is pretty well hidden. The mat is so flexible that you can actually attach the mat to itself, creating a circular floral vase! The grids are an inch square which makes it super easy to work with for attaching the frame to another surface. We'd recommend floral wire or wire ties as an extra measure for keeping them secured. Create breath-taking wedding and event Decor by attaching to a trellis or Arch. Fashion a stunning wall of flowers behind a head table which can double as an elegant photo backdrop. Use to mask or enhance a column, wall or door and accent with a colorful rose monogram or logo to mark the occasion! Pair with our identical Ivory Flower Wall or outline with a lively green wall like Boxwood Landscape Wall. If you want to create a design with other materials you can easily part the flowers and use the grid to attach items. If hanging from a wall or fence, use the grids to intertwine Fairy String Lights or create dimension with your flower wall by adding beautiful draping blossoms. This mat is an ideal size to use on drop ceilings with metal grids. Create a dreamy floral canopy by suspending the mat with magnet hooks, crystal or pearl strands. Hang sparkling crystal ornaments for added glam. If you need a wall that will be seen from both sides, use the easily accessible grids and tie 2 mats back-to-back. You can even cut the plastic grid frame to make creative shapes or use to cover the bottom of a stand. Many, many ways to use this Floral Wall Mat to make your dream garden a reality! TO AVOID THE LOOK OF "SEAMS" ON A FLOWER WALL USING A PIPE AND DRAPE STRUCTURE: The most critical point is to make sure that each wall panel is secured in multiple spots, not only to the pipes but to each adjoining panel as well. The tie should be a material that won't relax or stretch like burlap twine, wire ties or zip ties. When displaying multiple panels next to each other, each wall needs to be pulled taut so the seams don't show. The flowers extend over the frame, hiding the pipes while creating a seamless look. Another key is to secure each panel to the pipe AND to the adjoining panel in at least 3 spots. You can also connect the panels by using the pegs & holes on the sides of the plastic frame. Additionally, running picture wire horizontally, vertically and diagonally on the pipe and drape structure before adding the walls allows for a firmer background to support the walls. Please view our instructional video.]]>wild-pagevideo-use-flower-walls-on-flower-arch1cream-roses-flower-wall-backdropwhite-roses-wedding-walls-of-flowerswedding-wall-of-flowers-faux-ivory-rosesivory-floral-backdrop-panel-rosescurved-flower-wall-for-arches-and-columnspremium-flower-wall-huge-cream-silk-flowerssilk-flower-wall-cream-roses-and-hydrangeaivory-plumeria-flower-wall-mat-2feetivory-flower-wall-wedding-backdropcream-flower-wall-wedding-photo-backdropoff-white-flower-mat-backdrop-wallpremium-pure-white-rose-flower-wallwhite-rose-hydrangea-flower-wallfloral-backdrop-wedding-photo-wall-whitewhite-flower-wall-hydrangeaswedding-flower-wall-backdrop-creamy-whitepink-ivory-roses-flower-wallpeach-pink-ivory-flower-wallivory-peach-flower-wallsblush-pink-cherry-blossom-flower-wall-matroses-blush-pink-floral-wall-panelblush-pink-premium-flower-wall-hydrangeablush-pink-flower-wall-wedding-backdroppink-and-cream-hydrangea-flower-wallflower-wall-pink-rosespink-flower-backdrop-walltwo-tone-wall-of-flowers-blush-pinkpink-silk-roses-flower-wall-backdropextra-full-mixed-variety-flower-wall-backdropcolorful-flower-wall-panel-backdroppurple-pink-flower-wall-panelspurple-roses-silk-flower-wall-backdroppurple-silk-flower-backdrop-wall-panelsblack-flower-wall-backdrop-panelsilk-red-roses-wedding-flower-wall-matred-flower-wall-dark-center-bloomsflower-wall-redpremium-red-silk-flower-wall-extra-fullgold-hydrangea-walls-silk-wedding-flowerssilk-flower-walls-metallic-silver-event-backdropsflower-wall-backdrop-aqua-bluehydrangea-silk-flower-wall-mat-green4pc-silk-rose-flower-wall-set-red4pc-silk-rose-flower-wall-set-white4pc-silk-rose-flower-wall-set-ivory4pc-silk-rose-flower-wall-set-pinkfoam-roses-wall-backdrop4-giant-ivory-real-feel-foam-roseslarge-pink-foam-flowers-wallscapegiant-foam-floating-rose-with-stem-ivory-17inchhuge-white-foam-flower-20inch-wide20inch-wide-giant-foam-flower-ivorypaper-flower-rose-gardenia-off-white-12inchespaper-flower-rose-gardenia-off-white-14inchespaper-flower-rose-gardenia-off-white-19inchespaper-flower-daisy-off-white-12inchespaper-flower-dahlia-off-white-12inchespaper-flower-cosmos-off-white-11inchesartificial-grass-wall-mat-natural-greengreen-living-wall-mat-artificial-hedgesboxwood-greenery-wall-mat-11inchesartificial-ferns-green-wall-panel-fr-20infaux-boxwood-plant-wall-mat-fr-20inhuge-artificial-green-wall-assorted-foliage-40inartificial--boxwood-greenery-garden-wallartificial-greenery-garden-wall-panelsboxwood-wall-artificial-green-panelartificial-boxwood-mat-greenery-backdropgreenery-foliage-wall-matartificial-grass-mat-runnerfloral-chandelierfloral-chandelier-event-kitartificialgreenerywhite-flower-chandelier-wedding-decorfloral-walls-greenery-backdropsflfadefasilkflowersropokibabrandspmybuswtgereafreestanding-flower-wall-frame-metal-setof4picture-frame-cutsouts-white-plastic-4pc3d-pvc-laser-cut-backdrop-8ft-tall-propxlrg-5pc-freestanding-3d-laser-cut-backdroppaintable-flower-backdrop-laser-cut-3d5pc-xlrg-event-backdrop-freestanding-archesflower-wall-backdrop-stand-instructions1https://s.yimg.com/aah/shopwildthings/flower-wall-panels-for-sale-44.jpghttps://s.yimg.com/aah/shopwildthings/flower-wall-panels-for-sale-45.jpgWhen it comes to Wedding Flower Walls, most clients want them but few can stomach the cost of "real" florals. Measure the space you'd like to cover, and then choose how many of our panels you'll need to cover that space. We are confident that our pricing will make this purchase a no-brainer, no matter how many square feet you need to cover! Event Planners Rejoice! You'll sell this set up again and again! We LOVE real flowers and our floral designer clients do the most beautiful and creative work. Even many of them have told us that Artificial Flower Walls can be mixed with real florals around the rest of the event for a spectacular and more budget-friendly event. Silk Flower Walls are also a first-choice for Portrait Photographers for a beautiful and affordable Floral Backdrop that will stay beautiful forever. Our Flower Wall Panels are designed for ease-of-use. They look so very real, but the back is created using a plastic grid that has holes for hanging. We've even used thumbtacks to hang them when needed! Staple guns work well, too. Simply attach them to whatever inexpensive plywood backdrop you've got handy, and it will be beautifully disguised by our Silk Flower Wall Panels!wild-pagecatrfatr1bend-branch-faux-white-flowering-tree-tallwhite-flowering-5ft-wedding-treefaux-cherry-blossom-tree-white-6ftcream-flowering-dogwood-tree-artificial-6-footwhite-dogwood-tree-flowering-lifesize-artificialsilk-weeping-cherry-tree-9ft-whitepink-dogwood-heart-shaped-tree-12-feetwhite-green-lifesize-flowering-tree-propartificial-cream-cherry-blossom-tree-6ftsnow-fountain-white-weeping-cherry--treecream-flowering-wisteria-tree-heart-archartificial-lifesize-artificial-flower-tree-propwhite-green-artificial-tree-lifesize-wedding-propcream-dogwood-lifesize-silk-flowering-treeartificial-cherry-blossom-tree-can-change-flowersartificial-cream-flowering-dogwood-tree-6ftfaux-pink-flowering-dogwood-tree-6ftlarge-pink-and-white-flowering-wedding-tree-archlarge-pink-artificial-flowering-wedding-treeartificial-pink-flowering-tree-archblush-pink-12-foot-artificial-tree-floweringlight-pink-event-design-tree-6-feet-flowerspink-cherry-tree-event-wedding-artificialfuchsia-flowering-tree-10ft-wedding-arch11ft-flowering-wisteria-tree-dark-fuchsia-pink7ft-artificial-wisteria-tree-flowering-purpleextra-large-artificial-tree-green-event-propartificial-weeping-willow-tree-greensilk-flower-garlandssilkflowersropokiba1https://s.yimg.com/aah/shopwildthings/flowering-artificial-wedding-trees-12.jpghttps://s.yimg.com/aah/shopwildthings/flowering-artificial-wedding-trees-13.jpg Use them as is - they take just moments to set up! You could also add Crystal Garlands, Pendants, and more if you'd like to add a little sparkle to the look. Add our Battery Operated LED Lights for a cool glow! Bend the branches so that they are shaped however you'd like!]]>wild-pageexlocu11https://s.yimg.com/aah/shopwildthings/flowering-cherry-blossom-multi-pink-10-5-feet-tall-x-8-feet-wide-sideswept-create-arch-using-2-35.jpghttps://s.yimg.com/aah/shopwildthings/flowering-cherry-blossom-multi-pink-10-5-feet-tall-x-8-feet-wide-sideswept-create-arch-using-2-36.jpgButterfly Garlands or Firefly Fairy Pearl Lights for a dazzling nighttime effect. For special events, create a one-of-a-kind focal point, use as a picturesque photo backdrop or form a floral canopy to provide an elegant setting for wedding ceremonies. For restaurants, stores, hotels or large venues, this tree brings fresh color, height and natural beauty, giving a garden nature feel but because of the height and sideways structure, it takes up minimal space. Add some Fairy String Lights for extra scrumptousness! From top to bottom, this is a quality made tree and the extra stabilizers for the base were a special requirement of ours so that event planners and designers can relax, knowing this tree is stable and it's actually pretty easy to scootch around if you want to relocate it. To permanently install it, the base itself has 4 holes so you can secure this tree to the floor. We recommend attaching the stabilizers before assembling the branches. For sensational wedding and event decor, we work hard to get only the best so that you get only the best and our line of decorative flowering trees are exotic and yummy from top to bottom!]]>wild-pageexlocu11https://s.yimg.com/aah/shopwildthings/flowering-cherry-blossom-pink-white-10-5-feet-tall-x-8-feet-wide-sideswept-create-arch-using-2-38.jpghttps://s.yimg.com/aah/shopwildthings/flowering-cherry-blossom-pink-white-10-5-feet-tall-x-8-feet-wide-sideswept-create-arch-using-2-39.jpgButterfly Garlands or Firefly Fairy Pearl Lights for a dazzling nighttime effect. For special events, create a one-of-a-kind focal point, use as a picturesque photo backdrop or form a floral canopy to provide an elegant setting for wedding ceremonies. For restaurants, stores, hotels or large venues, this tree brings color, height, energy and gives a garden feel but because of the height, it takes up minimal space. When placed next to a wall, it comes out 5 1/2'. Add some Fairy String Lights for extra scrumptousness! From top to bottom, this is a quality made tree and the extra stabilizers for the base were a special requirement of ours so that event planners and designers can relax, knowing this tree is stable and it's actually pretty easy to scootch around if you want to relocate it. To permanently install it, the base itself has 4 holes so you can secure this tree to the floor. We recommend attaching the stabilizers before assembling the branches. For sensational wedding and event decor, we work hard to get only the best so that you get only the best and our line of decorative flowering trees are exotic and yummy from top to bottom!]]>wild-pageexlocu11https://s.yimg.com/aah/shopwildthings/blush-pink-artificial-cherry-blossom-wedding-tree-lifestize-artificial-12.jpghttps://s.yimg.com/aah/shopwildthings/blush-pink-artificial-cherry-blossom-wedding-tree-lifestize-artificial-13.jpgButterfly Garlands or Firefly Fairy Pearl Lights for a dazzling nighttime effect. For special events, create a one-of-a-kind focal point, use as a picturesque photo backdrop or form a floral canopy to provide an elegant setting for wedding ceremonies. For restaurants, stores, hotels or large venues, this tree brings fresh color, height and natural beauty, giving a garden nature feel but because of the height and sideways structure, it takes up minimal space. Add some Fairy String Lights for extra scrumptousness! From top to bottom, this is a quality made tree and the extra stabilizers for the base were a special requirement of ours so that event planners and designers can relax, knowing this tree is stable and it's actually pretty easy to scootch around if you want to relocate it. To permanently install it, the base itself has 4 holes so you can secure this tree to the floor. We recommend attaching the stabilizers before assembling the branches. For sensational wedding and event decor, we work hard to get only the best so that you get only the best and our line of decorative flowering trees are exotic and yummy from top to bottom!]]>wild-pagepinks1https://s.yimg.com/aah/shopwildthings/artificial-silk-pink-cherry-tree-lifesize-65.jpghttps://s.yimg.com/aah/shopwildthings/artificial-silk-pink-cherry-tree-lifesize-66.jpgassembling this tree literally takes under 5 minutes! Easy up, easy down, easy transporting and storing! Each main branch consists of 9 smaller branches that are very durable and completely bendable! Shape it how you'd like and it WILL keep its shape. The base of the 10 main branches is a square metal housing which simply slides into the square holes on the trunk and the look is completely seamless. The branches meld perfectly into the trunk. Very quick and easy! In the center of the base of the top 4 branches there is an area about 1 1/2" in diameter that could easily hold a small bottle of scented oil (like cherry blossom!) or a battery operated DazzLED light! Worried about stability? Well don't. This tree weighs 21.7 lbs. and at the bottom is an 11 3/4" square metal plate. The tree trunk is attached to the base - they are 1 unit that will not come apart. Additionally, the metal base has 4 holes (each 3/4" in diameter) so you can 'permanently' install this tree. It's hard to believe but there are so many branches and blossoms that you could actually remove several of the main stems and use them in a vase and you won't notice them missing from the tree. Seriously, that's just how full it is! Add butterfly garlands...OOH! Hang Crystal Garlands, Pendants and Ornaments or hang glass ball candle holders...AHH! You could even expound on the realistic qualities of this tree by placing in a planter box! Around the house this is perfect for a covered patio, sunroom or foyer. For restaurants, stores, hotels and lobbies, welcome your guests with eye-popping blossoms and celebrate the holidays by decorating with LED String Lights! If you're planning a large venue, place on a table and make this the grand showpiece of the room! For sensational wedding and event decor, we work hard to get only the best so that you get only the best and our line of decorative flowering trees are luscious from top to bottom! It's sure hard to beat the beauty of a cherry blossom tree in full bloom so why not enjoy this elegant flowering tree year round!]]>wild-pagewhclde1https://s.yimg.com/aah/shopwildthings/flowering-dogwood-tree-ivory-11-feet-tall-sideswept-create-arch-using-2-56.jpghttps://s.yimg.com/aah/shopwildthings/flowering-dogwood-tree-ivory-11-feet-tall-sideswept-create-arch-using-2-57.jpgButterfly Garlands or Firefly Fairy Pearl Lights for a dazzling nighttime effect. For special events, create a one-of-a-kind focal point, use as a picturesque photo backdrop or form a floral canopy to provide an elegant setting for wedding ceremonies. For restaurants, stores, hotels or large venues, this tree brings color, height, energy and gives a garden feel but because of the height, it takes up minimal space. When placed next to a wall, it comes out 5 1/2'. Add some Fairy String Lights for extra scrumptousness! From top to bottom, this is a quality made tree and the extra stabilizers for the base were a special requirement of ours so that event planners and designers can relax, knowing this tree is stable and it's actually pretty easy to scootch around if you want to relocate it. To permanently install it, the base itself has 4 holes so you can secure this tree to the floor. We recommend attaching the stabilizers before assembling the branches. For sensational wedding and event decor, we work hard to get only the best so that you get only the best and our line of decorative flowering trees are exotic and yummy from top to bottom!]]>wild-pagewhclde1https://s.yimg.com/aah/shopwildthings/heart-shaped-tree-wedding-decor-white-dogwood-49.jpghttps://s.yimg.com/aah/shopwildthings/heart-shaped-tree-wedding-decor-white-dogwood-50.jpgWe recommend attaching the stabilizers before assembling the branches. The trunk pieces and main branches are numbered for easy assembling. The flowered branches are identical and have a metal housing on the end which simply slides into the square holes on the trunk and the look is completely seamless! In 15 minutes, you can assemble this tree and spread out the bendable branches for eye-popping decor! This tree weighs 85lbs. Top quality construction makes our trees an event planners dream and they bring life and energy to any room, are visually pleasing and calming to the soul. Add some butterfly garlands or hang Firefly Fairy Pearl Lights for a dazzling nighttime effect. For special events, create a lovely focal point or use as a picturesque photo backdrop and what a perfect backdrop for a wedding ceremony! For restaurants, stores, hotels or large venues, this tree adds elegance, vitality and gives a romantic garden feel. Add some Fairy String Lights for extra scrumptousness! From top to bottom, this is a quality made tree and the extra stabilizers for the base were a special requirement of ours so that event planners and designers can relax, knowing this tree is stable and it's actually pretty easy to scootch around if you want to relocate it. To permanently install it, the base itself has 4 holes so you can secure this tree to the floor. For sensational wedding and event decor, we work hard to get only the best so that you get only the best and our line of decorative green and flowering trees are exotic and yummy from top to bottom!]]>wild-pagepinks1https://s.yimg.com/aah/shopwildthings/flowering-dogwood-cherry-tree-pink-wedding-decor-47.jpghttps://s.yimg.com/aah/shopwildthings/flowering-dogwood-cherry-tree-pink-wedding-decor-48.jpgButterfly Garlands or Firefly Fairy Pearl Lights for a dazzling nighttime effect. For special events, create a one-of-a-kind focal point, use as a picturesque photo backdrop or form a floral canopy to provide an elegant setting for wedding ceremonies. For restaurants, stores, hotels or large venues, this tree brings color, height, energy and gives a garden feel but because of the height, it takes up minimal space. When placed next to a wall, it comes out 5 1/2'. Add some Fairy String Lights for extra scrumptousness! From top to bottom, this is a quality made tree and the extra stabilizers for the base were a special requirement of ours so that event planners and designers can relax, knowing this tree is stable and it's actually pretty easy to scootch around if you want to relocate it. To permanently install it, the base itself has 4 holes so you can secure this tree to the floor. We recommend attaching the stabilizers before assembling the branches. For sensational wedding and event decor, we work hard to get only the best so that you get only the best and our line of decorative flowering trees are exotic and yummy from top to bottom!]]>wild-pageexlocu11https://s.yimg.com/aah/shopwildthings/fuschia-pink-flowering-artificial-tree-lifesize-21.jpghttps://s.yimg.com/aah/shopwildthings/fuschia-pink-flowering-artificial-tree-lifesize-22.jpgButterfly Garlands or Firefly Fairy Pearl Lights for a dazzling nighttime effect. For special events, create a one-of-a-kind focal point, use as a picturesque photo backdrop or form a floral canopy to provide an elegant setting for wedding ceremonies. For restaurants, stores, hotels or large venues, this tree brings fresh color, height and natural beauty, giving a garden nature feel but because of the height and sideways structure, it takes up minimal space. Add some Fairy String Lights for extra scrumptousness! From top to bottom, this is a quality made tree and the extra stabilizers for the base were a special requirement of ours so that event planners and designers can relax, knowing this tree is stable and it's actually pretty easy to scootch around if you want to relocate it. To permanently install it, the base itself has 4 holes so you can secure this tree to the floor. We recommend attaching the stabilizers before assembling the branches. For sensational wedding and event decor, we work hard to get only the best so that you get only the best and our line of decorative flowering trees are exotic and yummy from top to bottom!]]>wild-pagesilk-flower-garlands1https://s.yimg.com/aah/shopwildthings/light-pink-flowering-tree-centerpiece-flowers-56.jpghttps://s.yimg.com/aah/shopwildthings/light-pink-flowering-tree-centerpiece-flowers-57.jpgWhite Mermaid Vase, fluff the stems to your desired look, stand back and admire! Create breathtaking floral ceilings or suspend from a Wedding Arch, trellis, pipe and drape canopy, banister or railing. Another accent piece that's quick to decorate and provides sophisticated focal points are Roman Pillar Column Stands which have 4 cut outs on the top plate to insert these long stemmed beauties. Luxury looks don't have to be expensive or hard to achieve. Start with stress-free artificial florals and take pleasure in the time and money you just saved!]]>wild-pagesilk-flower-garlands1https://s.yimg.com/aah/shopwildthings/artificial-pink-flower-branch-spray-67.jpghttps://s.yimg.com/aah/shopwildthings/artificial-pink-flower-branch-spray-68.jpgCrystal Beaded Cylinder Vase , fluff the stems to your desired look, stand back and admire! Create breathtaking floral chandeliers or beautify a Ceremony Arch, pipe and drape canopy, trellis, banister or railing. Another accent piece that's quick to decorate and provides sophisticated focal points are Roman Pillar Column Stands which have 4 cut outs on the top plate to insert these long stemmed beauties. Luxury looks don't have to be expensive or hard to achieve. Start with stress-free artificial florals and take pleasure in the time and money you just saved!]]>wild-pagesilk-flower-garlands1https://s.yimg.com/aah/shopwildthings/artificial-flower-branch-picks-peach-44.jpghttps://s.yimg.com/aah/shopwildthings/artificial-flower-branch-picks-peach-45.jpgWhite Mermaid Vase, fluff the stems to your desired look, stand back and admire! Create breathtaking floral chandeliers or suspend from a Wedding Arch, trellis, pipe and drape canopy, banister or railing. Another accent piece that's quick to decorate and provides sophisticated focal points are Roman Pillar Column Stands which have 4 cut outs on the top plate to insert these long stemmed beauties. Luxury looks don't have to be expensive or hard to achieve. Start with stress-free artificial florals and take pleasure in the time and money you just saved!]]>wild-pagesilk-flower-garlands1https://s.yimg.com/aah/shopwildthings/white-artificial-flower-branches-60.jpghttps://s.yimg.com/aah/shopwildthings/white-artificial-flower-branches-61.jpgCrystal Beaded Trumpet Vase, fluff the stems to your desired look, stand back and admire! Create a breathtaking overhead floral chandelier or a dreamy floral event canopy by wire tying these branches to a Pipe and Drape Ceremony Gazebo, wedding arch, trellis, banister or railing. Another accent piece that's quick to decorate and provides sophisticated focal points are Roman Pillar Column Stands which have 4 cut outs on the top plate to insert these long stemmed beauties. Luxury looks don't have to be expensive or hard to achieve. Start with stress-free artificial florals and take pleasure in the time and money you just saved!]]>wild-pagesilk-flower-garlands1https://s.yimg.com/aah/shopwildthings/pink-flower-spray-fluffy-39.jpghttps://s.yimg.com/aah/shopwildthings/pink-flower-spray-fluffy-40.jpgDecorative Pillar Columns, the substantial height of this flowering branch instantly makes a glamorous floral accent piece and for elegant centerpieces, it's hard to top fluffy blossoms in a graceful vase like an Eiffel Tower Vase. The easy to bend stems are ideal for attaching to ceremony arches or for creating a floral chandelier using a 2 Tier Metal Frame with Crossbars. The bottom line is that when your decorating time is short and your event budget needs a break, starting with silk florals can be the game changer you need!]]>wild-pagesilk-flower-garlands1https://s.yimg.com/aah/shopwildthings/white-pink-artificial-floral-pick-fluffy-41.jpghttps://s.yimg.com/aah/shopwildthings/white-pink-artificial-floral-pick-fluffy-42.jpgDecorative Pillar Columns, the substantial height of this flowering branch instantly makes a glamorous floral accent piece and for elegant centerpieces, it's hard to top fluffy blossoms in a graceful vase like an Eiffel Tower Vase. The easy to bend stems are ideal for attaching to ceremony arches or for creating a floral chandelier using a 2 Tier Metal Frame with Crossbars. The bottom line is that when your decorating time is short and your event budget needs a break, starting with silk florals can be the game changer you need!]]>wild-pageexlocu11https://s.yimg.com/aah/shopwildthings/huge-artificial-floral-canopy-white-wedding-tree-12.jpghttps://s.yimg.com/aah/shopwildthings/huge-artificial-floral-canopy-white-wedding-tree-13.jpgButterfly Garlands, or decorate for holidays and themed events. For special occasions, create a one-of-a-kind focal point, use as a picturesque photo backdrop or form a floral canopy to provide an elegant setting for wedding ceremonies. For restaurants, stores, hotels or large venues, this tree brings freshness, height and natural beauty, giving a garden nature feel. Add some Fairy String Lights for extra scrumptousness! From top to bottom, this is a quality made tree and the extra stabilizers for the base were a special requirement of ours so that event planners and designers can relax, knowing this tree is stable and it's actually pretty easy to scootch around if you want to relocate it. To permanently install it, the base itself has 4 holes so you can secure this tree to the floor. We recommend attaching the stabilizers before assembling the branches. For sensational wedding and event decor, we work hard to get only the best so that you get only the best and our line of decorative flowering trees are exotic and yummy from top to bottom!]]>wild-pageexlocu11https://s.yimg.com/aah/shopwildthings/artificial-wisteria-tree-wedding-arch-cream-12.jpghttps://s.yimg.com/aah/shopwildthings/artificial-wisteria-tree-wedding-arch-cream-13.jpgButterfly Garlands or Firefly Fairy Pearl Lights for a dazzling nighttime effect. For special events, create a one-of-a-kind focal point, use as a picturesque photo backdrop or form a floral canopy to provide an elegant setting for wedding ceremonies. For restaurants, stores, hotels or large venues, this tree brings fresh color, height and natural beauty, giving a garden nature feel but because of the height and sideways structure, it takes up minimal space. On this tree it's very easy to add some Fairy String Lights for extra scrumptousness! For sensational wedding and event decor, we work hard to get only the best so that you get only the best and our line of decorative flowering trees are exotic and yummy from top to bottom!]]>wild-pageexlocu11https://s.yimg.com/aah/shopwildthings/fuschia-pink-artificial-wisteria-tree-lifesize-12.jpghttps://s.yimg.com/aah/shopwildthings/fuschia-pink-artificial-wisteria-tree-lifesize-13.jpgButterfly Garlands or Firefly Fairy Pearl Lights for a dazzling nighttime effect. For special events, create a one-of-a-kind focal point, use as a picturesque photo backdrop or form a floral canopy to provide an elegant setting for wedding ceremonies. For restaurants, stores, hotels or large venues, this tree brings fresh color, height and natural beauty, giving a garden nature feel but because of the height and sideways structure, it takes up minimal space. Add some Fairy String Lights for extra scrumptousness! From top to bottom, this is a quality made tree and the extra stabilizers for the base were a special requirement of ours so that event planners and designers can relax, knowing this tree is stable and it's actually pretty easy to scootch around if you want to relocate it. To permanently install it, the base itself has 4 holes so you can secure this tree to the floor. We recommend attaching the stabilizers before assembling the branches. For sensational wedding and event decor, we work hard to get only the best so that you get only the best and our line of decorative flowering trees are exotic and yummy from top to bottom!]]>wild-pageexlocu11https://s.yimg.com/aah/shopwildthings/purple-flowering-wisteria-tree-artificial-lifesize-shopwildthings-12.jpghttps://s.yimg.com/aah/shopwildthings/purple-flowering-wisteria-tree-artificial-lifesize-shopwildthings-13.jpgButterfly Garlands or Firefly Fairy Pearl Lights for a dazzling nighttime effect. For special events, create a one-of-a-kind focal point, use as a picturesque photo backdrop or form a floral canopy to provide an elegant setting for wedding ceremonies. For restaurants, stores, hotels or large venues, this tree brings fresh color, height and natural beauty, giving a garden nature feel but because of the height and sideways structure, it takes up minimal space. Add some Fairy String Lights for extra scrumptousness! For sensational wedding and event decor, we work hard to get only the best so that you get only the best and our line of decorative flowering trees are exotic and yummy from top to bottom!]]>wild-pagetrees-and-floral1jumbo-faux-flowers-with-removable-stemgiant-red-silk-flower-prophuge-flower-props-aisle-decorationsoversized-red-silk-rosesgigantic-silk-roses-removable-stemgiant-pink-silk-flowers-removable-stemjumbo-artificial-pink-roses-with-stemoversize-silk-flower-propsoversized-faux-flower-decorationsjumbo-ivory-silk-rose-propsgiant-silk-flowers-for-propshuge-ivory-silk-roses-removable-stem4pc-silk-rose-flower-wall-set-red4pc-silk-rose-flower-wall-set-white4pc-silk-rose-flower-wall-set-ivory4pc-silk-rose-flower-wall-set-pinkfoam-roses-wall-backdrop4-giant-ivory-real-feel-foam-roseslarge-pink-foam-flowers-wallscapegiant-foam-floating-rose-with-stem-ivory-17inchhuge-white-foam-flower-20inch-wide20inch-wide-giant-foam-flower-ivorypink-floating-roses-2inch-foam-12pcsfoam-floating-pink-roses-3inch-12pcsfloating-foam-roses-pink-100pcsfloating-foam-roses-white-100pcsfloating-foam-roses-ivory-100pcsfloating-foam-roses-coral-100pcsreal-feel-dark-blue-floating-rosesfloating-roses-real-feel-foam-purplefloating-foam-rose-flowers-2inch-ivory-12pcsfloating-foam-roses-3inch-ivorywhite-floating-foam-roses-12pcs-2inchwhite-wedding-roses-3inch-real-feel-foamfloating-foam-rose-stem-white-15inchesfloating-foam-rose-stem-ivory-15inchesmini-rose-set-144pc-white-1inch-foam-flowers1inch-foam-roses-144pc-ivory-wedding-flowerspaper-flower-rose-gardenia-off-white-12inchespaper-flower-rose-gardenia-off-white-14inchespaper-flower-rose-gardenia-off-white-19inchespaper-flower-daisy-off-white-12inchespaper-flower-dahlia-off-white-12inchespaper-flower-cosmos-off-white-11inchessilkflowersbecrcohangingcandlefloral-walls-greenery-backdropsartificialgreeneryropokibagaandstropesiropebsfloral-centerpiece-kitlarge-stem-flower-and-branch-metal-standstand-for-long-stemmed-oversize-faux-flowersfreestanding-flower-wall-frame-metal-setof4large-crown-shaped-floral-foamcraft-floral-foam-large-heart-shapesilk-flower-garlands1https://s.yimg.com/aah/shopwildthings/oversized-flower-party-props-47.jpghttps://s.yimg.com/aah/shopwildthings/oversized-flower-party-props-48.jpgFlower Wall Panels and add some of these to create even more visual interest along the top! Need more matching florals? Be sure to check out our Hanging Floral Garlands which can be used to create a spectacular Floral Ceiling! Need something special for the tabletop? Our Floral Bouquets and Individual Stems are not to be missed.]]>wild-pagefloral-walls-greenery-backdrops11https://s.yimg.com/aah/shopwildthings/free-flower-wall-backdrop-stand-instructions-video-60.jpghttps://s.yimg.com/aah/shopwildthings/free-flower-wall-backdrop-stand-instructions-video-61.jpgScroll down under the video to see your shopping list, instructions, and more photos of this job under construction. Shopping List: Note: Most local lumber stores will make these cuts for you at no charge. There are no complicated angles, making this so easy! • 2 Pcs Plywood 4’ x 8’ 3/8” Thick (backdrop walls)
• 2 Pcs 2” x 4”’s – Cut to 46 ¼” Long Each (legs)
• 2 Pcs 2” x 4”’s – Cut to 24” Long Each (braces in between 2 walls)
• 2 Pcs 2” x 4”’s – Cut to 6” Long Each (anchors for legs)
• 1 Pc 2” x 4”’s – Cut to 72” Long Each (center brace for legs)
• 1 Gallon Green Paint (half gallon may work)
• 28 Pcs 6” x 1 5/8” Coarse Thread Drywall Screws
• 12 Pcs 8” x 3” Course Thread Drywall Screws Building Instructions: (PRINT THE PHOTO FOR FIGURES) 1. Lay the (2) 4’ x 8’ Plywood Sheets side by side. – Figure 1 2. Center one 2” x 4” x 24” just below the edge of the top and bottom of the 4 x 8 sheets and trace outline (4 each) – See Figure 2 3. Remove 2” x 4” x 24” – Predrill 1/8” holes evenly in the areas on both sheets – See Figure 2 4. Stand one sheet 4’ x 8’ up. Have an assistant hold (1) 2” x 4” at the top of the traced area, placing half of the 2” x 4” on the plywood 5. Using (4) 6 x 1 5/8” screws, fasten the 2 x 4 to the plywood and repeat at the bottom 6. Match up the other 4’ x 8’ sheet and repeat the previous process. See Figure 4 7. Measure 45” up from the bottom at several points across the plywood. Using a straight edge, mark a line across the plywood. Use this as a guide for the 72” 2x4. Using your mark, center the 2x4 on the Plywood. Trace the outline of the 2x4 and remove. Predrill 1/8” holes (12) evenly spaced. Hold 2x4 back in the traced area and secure with (12) 6 x 1 5/8” screws from the front side. See Figures 5, 6 and 7 8. Place (1) 2”x 4” x 6” at the end of the 72” 2x4 and secure using (4) 8” x 3” screws. Repeat on the other side. See Figure 8 and Photograph 9. Take the (2) 46 ¼” 2 x 4’s and pre-drill 1/8” hole approximately 2” down and centered at one end. Repeat on the second 2 x 4. See Figure 9 10. With Assistance, stand the wall up almost 90 degrees. Place 46 ¼” 2x4 with Pre-Drilled Holes up to 2x4 doubles section at the end See Figure 10 11. Secure with (1) 8” x 3” Screw using Pre-drilled 1/8” hole. Re-adjust wall angle (if necessary) and secure with (2) more 8” x 4” screws. Make sure that each screw penetrates the doubled 2x4” Repeat steps 9 through 11 on the opposite side. (see Figures 11, 8, and the Photograph showing this back area) 12. Carefully release wall and observe steadiness and ability to “freestand” There should be a light lean toward the support legs. See Figure 12 13. Optional: For additional support and strength, an anchor line can be attached by drilling a hole on either side approximately 60” up from the bottom. Using a cinderblock or weighted plate – secure a rope line to the back of the wall and adjust tension by moving the block or weight away from the wall. Keep enough tension so the wall will not tip forward. If the wall is used outdoors on a soft surface (i.e. grass or dirt, drill holes in the support legs at the bottom and drive spikes into the ground. See Figure 13 Important: The stability of the structure should be checked after the application of flower panels is complete. Gently and carefully apply pressure from the front and then the rear to make sure that the structure is secure and will not tip over in either direction. See Instruction #13 to add more stability if you’re concerned. The sample Flower Wall that we built in the video was stable on a concrete floor even full of 24 panels of flowers without extra support. To see a larger copy of these drawings below, please scroll to the main images at the top of the page. You can enlarge that image quite a bit and print it. ]]>wild-pagevispdicrco1https://s.yimg.com/aah/shopwildthings/fringe-string-curtain-columns-up-to-4-feet-wide-x-20-feet-long-dozens-of-color-choices-103.jpghttps://s.yimg.com/aah/shopwildthings/fringe-string-curtain-columns-up-to-4-feet-wide-x-20-feet-long-dozens-of-color-choices-104.jpg1 Foot Diameter String Fringe Column (actual size is 11.25" diameter)
Item # 999121
CLICK HERE FOR 1 Foot DIAMETER PAGE
Choose Length from 6 Feet Long to 20 Feet Long
Choose Fire Treatment Option
(No Minimum if in-stock curtains are used)
Prices Start at $55.99 Each - Comes complete with hanging hardware. 2 Foot Diameter String Fringe Column (actual size is 22.50" diameter)
Item # 999122
CLICK HERE FOR 2 Foot DIAMETER PAGE
Choose Length from 6 Feet Long to 20 Feet Long
Choose Fire Treatment Option
(No Minimum if in-stock curtains are used)
Prices Start at $98.98 Each - Comes complete with hanging hardware. 3 Foot Diameter String Fringe Column (actual size is 33" diameter)
Item # 999123
CLICK HERE FOR 3 Foot DIAMETER PAGE
Choose Length from 6 Feet Long to 20 Feet Long
Choose Fire Treatment Option
(No Minimum if in-stock curtains are used)
Prices Start at $146.97 Each - Comes complete with hanging hardware. 4 Foot Diameter Inch Diameter String Fringe Column (actual size is 44" diameter)
Item # 999124
CLICK HERE FOR 4 Foot DIAMETER PAGE
Choose Length from 6 Feet Long to 20 Feet Long
Choose Fire Treatment Option
(No Minimum if in-stock curtains are used)
Prices Start at $184.96 Each - comes complete with hanging hardware. ShopWildThings String Columns are fabricated here in our facility in Lake Havasu City, AZ. They are beautifully constructed of the finest materials and are heavy duty. Our clients find them to be perfect for Retail Spaces, Meeting Spaces, Trade Shows, Event, Weddings, Dances, and just about any special event. There are so many options, but here is what you really need to know: COLUMN DIAMETER: Our custom columns come in 4 widths: 12", 24", 36" and 44". STRING CURTAIN COLORS AND LENGTHS: We stock the most popular colors and sizes so depending on your specific requirements, we can most likely accommodate your order. Please see our In-Stock String Curtain Colors and Sizes. Then, just give us a call at 928.855.6075 so we assist in completing your order. Optionally, click the Contact button at the top of this page and complete the form to send us a quick message. Our helpful team would LOVE to work with you! If we do not have your desired color or length in stock, no problem! Just select your color from our CUSTOM COLOR CHART BELOW. You can also choose to have your columns Fire Treated, as well. Some venues require it. Then please call us at 928.855.6075 to assist with your order and to see if there is a minimum order requirement. To avoid a minimum order requirement, please select an in-stock color. The photos below show String Columns that we made for The Emmy Awards! Your Column will arrive fully constructed and ready to hang. It will include sturdy hanging chains and hardware, which will be attached. You will be able to hang your column in a matter of minutes, making this a perfect item for just about any application. We do the hard work for you. Our string columns are famously soft, beautifully made, and in use around the globe today. Another FABULOUS feature of the columns is that they can be doubled or tripled up, with colors mixed. The inside hanging chain set-up is ready to accept another item on the inside of each ring. You can use a 24" diameter column and hang a 12" diameter column inside! You can use the 44" diameter column and hang a 24" diameter column inside, AND a 12" diameter column inside of that if you like! Mix the colors to add some extra visual interest. To ensure that we get your order just right, we require Custom Orders to be reviewed and confirmed in writing (via email or fax) prior to production. Special Note : Custom Orders are non-refundable, non-returnable, and once production has begun, non-cancellable. Custom Orders do not qualify for Free UPS Ground Shipping, but we only charge our actual negotiated shipping rates. We are also always happy to let you use your shipping account number for any order placed with us.]]>wild-pagesilk-flower-garlands2https://s.yimg.com/aah/shopwildthings/frosted-eucalyptus-spray-2-5-feet-bendable-greenery-stem-26.jpghttps://s.yimg.com/aah/shopwildthings/frosted-eucalyptus-spray-2-5-feet-bendable-greenery-stem-27.jpgThere is a minimum order of 2 sprays. We all love flowers which are an essential element for weddings, special events and everyday decor, but adding greenery enhances any display and completes the visual. Create stylish centerpieces or focal points by placing in Reversible Trumpet Latour Vases along with tall silk sprays. The color of this spray complements soft colors like our Peachy Cream Dogwood Blossom while adding a nice contrast to darker colors like red and purple. Top event planners and designers are taking advantage of every part of their venues by adding overhead floral chandeliers to completely surround guests in luscious natural foliage and this spray is an ideal addition for lavish draping designs. Using a 2-Tier Display Frame, dangle flowers and greenery to create suspended floral magic! The long stalk can easily be attached to frames and structures like a wedding arch or trellis. Since our Roman Pillar Columns have 4 small cutouts on the top plate, this spray is an effortless addition while providing height and uniqueness.]]>wild-pagefeosfe2https://s.yimg.com/aah/shopwildthings/fuchsia-ostrich-feathers-13-15-spads-61.jpghttps://s.yimg.com/aah/shopwildthings/fuchsia-ostrich-feathers-13-15-spads-62.jpgThere is a minimum order of 2 feathers. Simply place them on a table or in vases, combine with floral Decor, bouquets and wreaths, cards, invitations and gifts, decorate hats and costumes. Feathers are just fun and our colorful ostrich feathers dyed in exciting and vibrant colors are ready to display! These are real feathers (not man-made), so not every feather is identical in shape - they will vary from 13" - 15" in length and the width or spread of the feathers tend to run about 6" - 7". They are sold as each so you will get 1 feather. Because of frequent damage in return shipping, we regret that this item is not returnable]]>wild-pagefeosfe1https://s.yimg.com/aah/shopwildthings/fuchsia-pink-ostrich-feathers-29-32-spads-52.jpghttps://s.yimg.com/aah/shopwildthings/fuchsia-pink-ostrich-feathers-29-32-spads-53.jpgBecause of frequent damage in return shipping, we regret that this item is not returnable]]>wild-page3dglorlahade11https://s.yimg.com/aah/shopwildthings/galvanized-metal-folding-ball-silver-12-31.jpghttps://s.yimg.com/aah/shopwildthings/galvanized-metal-folding-ball-silver-12-32.jpgGreenery Garlands and touches of colorful flowers draping from the sides. For a more compact look, Succulents with burlap and moss are perfect elements to enhance the ball. Easy to hang, great for a table, patio or garden, this wonderful accent piece will quickly become one of your favorite design elements! We offer various sizes of this galvanized metal sphere or mix up the look by pairing with our wrought iron folding balls that have a patina finish or our wrought iron folding balls with an antique brown finish. All complement each other very nicely and make an interesting focal point when you hang several in a vertical row, mixing the sizes and colors! The video below shows a similar product that we carry that comes in a set of three, but this item folds flat just like those in the video. So handy!]]>wild-page3dglorlahade11https://s.yimg.com/aah/shopwildthings/galvanized-metal-folding-ball-silver-18-12.jpghttps://s.yimg.com/aah/shopwildthings/galvanized-metal-folding-ball-silver-18-13.jpgGreenery Garlands and touches of colorful flowers draping from the sides. For a more compact look, Succulents with burlap and moss are perfect elements to enhance the ball. Easy to hang, great for a table, patio or garden, this wonderful accent piece will quickly become one of your favorite design elements! We offer various sizes of this galvanized metal sphere or mix up the look by pairing with our wrought iron folding balls that have a patina finish or our wrought iron folding balls with an antique brown finish. All complement each other very nicely and make an interesting focal point when you hang several in a vertical row, mixing the sizes and colors! The video below shows a similar product that we carry that comes in a set of three, but this item folds flat just like those in the video. So handy!]]>wild-page3dglorlahade11https://s.yimg.com/aah/shopwildthings/galvanized-metal-folding-ball-silver-24-12.jpghttps://s.yimg.com/aah/shopwildthings/galvanized-metal-folding-ball-silver-24-13.jpgGreenery Garlands and touches of colorful flowers draping from the sides. For a more compact look, Succulents with burlap and moss are perfect elements to enhance the ball. Easy to hang, great for a table, patio or garden, this wonderful accent piece will quickly become one of your favorite design elements! We offer various sizes of this galvanized metal sphere or mix up the look by pairing with our wrought iron folding balls that have a patina finish or our wrought iron folding balls with an antique brown finish. All complement each other very nicely and make an interesting focal point when you hang several in a vertical row, mixing the sizes and colors! The video below shows a similar product that we carry that comes in a set of three, but this item folds flat just like those in the video. So handy!]]>wild-page3dglorlahade11https://s.yimg.com/aah/shopwildthings/galvanized-metal-folding-ball-silver-8-11.jpghttps://s.yimg.com/aah/shopwildthings/galvanized-metal-folding-ball-silver-8-12.jpgGreenery Garlands and touches of colorful flowers draping from the sides. For a more compact look, Succulents with burlap and moss are perfect elements to enhance the ball. Easy to hang, great for a table, patio or garden, this wonderful accent piece will quickly become one of your favorite design elements! We offer various sizes of this galvanized metal sphere or mix up the look by pairing with our wrought iron folding balls that have a patina finish or our wrought iron folding balls with an antique brown finish. All complement each other very nicely and make an interesting focal point when you hang several in a vertical row, mixing the sizes and colors! The video below shows a similar product that we carry that comes in a set of three, but this item folds flat just like those in the video. So handy! ]]>wild-pagefuforhoandev1https://s.yimg.com/aah/shopwildthings/garden-stool-liang-black-69.jpghttps://s.yimg.com/aah/shopwildthings/garden-stool-liang-black-70.jpgWe regret that this oversized item does not qualify for the FREE SHIPPING offer. Please select the shipping method "Truck Freight - Complete Your Order, We Will Call You". We will get a Freight Quote for you right away and contact you with that information. Go ahead and submit your order online or call us on the phone at 928-855-6075. We will take care of getting the information that you need to complete your order as quickly as we can. We had to set this item up this way because the shipping varied too much across the country to have a "set price" that we felt was fair to all regions. This will allow us to charge exactly what we are charged instead of "close enough". Garden Stools are becoming more and more popular for use in both homes and events. In the home, a Ceramic Garden Stool might be used near the patio to hold supplies, drinks and more. Indoors they can be used to fill space where you need "just a little something", a splash of color, or something functional like an end table next to a chair or couch. Tuck a couple underneath of an entryway table to fill up that awkward space. Garden Stools are as much a piece of art for your home as they are functional. Our beautiful Ceramic garden stools are handmade, painted, and kiln fired. We inspect each and every one before it ships. Due to the handmade nature of this item, slight variations may occur. Apartment Therapy offered this fantastic article about the history of garden stools: "For the last few years, barrel-shaped ceramic stools have been a popular decorating accessory, adding luster, color or texture to a space while serving as little side tables or room accents. But where do they come from, and where were they traditionally used? Okay, the answer is in the title of the post: they come from China, and they were traditionally used in gardens. But read on to learn more about the fascinating origins of this familiar form. Believe it or not, barrel- or drum-shaped garden stools have been used in China for at least 1,000 years. They may have evolved out of the Buddhist garden tradition, where natural elements like tree stumps and smooth rocks were used as seats. Traditionally, Chinese homes were build around a courtyard, and with an emphasis on landscape and gardens, so outdoor furniture was essential. By the Song Dynasty (960-1279), these types of stools were used both indoors and outdoors as casual seating . Indoor stools were typically portable and made out of wood, while outdoor furniture, needing to withstand the elements, began to be made out of stone, glazed stoneware , or porcelain . The antique stools that are still extant tend to be from the late Ming Dynasty Ñ early 17th century Ñ and later, and they have a range of decoration, including fretwork, relief decoration, and pierced motifs. One common decoration is simulated nailheads, often around the upper and lower parts of the barrel form. The nailhead motif is left over from ancient Chinese drums, which had wood bodies with skins stretched over each end and affixed with nails. Although these ceramic drum-shaped stools have been exported to the West for about 300 years, it is only since the mid-20th century that they have gained such currency in American interiors Ñ and exteriors .]]>wild-pagefuforhoandev1https://s.yimg.com/aah/shopwildthings/garden-stool-sonoma-purple-lattice-59.jpghttps://s.yimg.com/aah/shopwildthings/garden-stool-sonoma-purple-lattice-60.jpgWe regret that this oversized item does not qualify for the FREE SHIPPING offer. Please select the shipping method "Truck Freight - Complete Your Order, We Will Call You". We will get a Freight Quote for you right away and contact you with that information. Go ahead and submit your order online or call us on the phone at 928-855-6075. We will take care of getting the information that you need to complete your order as quickly as we can. We had to set this item up this way because the shipping varied too much across the country to have a "set price" that we felt was fair to all regions. This will allow us to charge exactly what we are charged instead of "close enough". The room photo shows a similar stool in a black finish.]]>wild-pagewhclde1https://s.yimg.com/aah/shopwildthings/garland-vonda-clear-60-strand-of-chunky-acrylic-gems-42.jpghttps://s.yimg.com/aah/shopwildthings/garland-vonda-clear-60-strand-of-chunky-acrylic-gems-43.jpgThis cool new clear garland is made up of some great looking chunky beads that alternate in size, giving great visual appeal. Each bead is faceted so that it catches the light nicely. This garland features beads strung onto metal wire, giving it extra durability and a great look. The end of each strand is finished with a beautiful large 2.5" Long pendant. Total length of strand 60"wild-pagebudeitbugach1https://s.yimg.com/aah/shopwildthings/garland-butterfly-dark-royals-w-glitter-40.jpghttps://s.yimg.com/aah/shopwildthings/garland-butterfly-dark-royals-w-glitter-41.jpgThis vibrant colors of this AMAZING butterfly strand are only rivaled by the wings which are real feathers! The feather wings alternate from dark blue to royal blue and they are ornamentally decorated with dark blue, fuchsia and turquoise glitter. The underside of the wings have a thin coating which holds the feathers in place. The strand is 6.5' long and each butterfly has a wingspan of 6" wide by 3.5" long. They are evenly spaced along the monofiliment strand and there is a loop at the top of the garland and a clear, faceted bead at the bottom. The colors on these 9 butterflies are exquisite!wild-pagebudeitbugach1https://s.yimg.com/aah/shopwildthings/garland-nine-piece-butterfly-pink-glitter-39.jpghttps://s.yimg.com/aah/shopwildthings/garland-nine-piece-butterfly-pink-glitter-40.jpgThis splendid butterfly strand is AMAZING! The wings of this spectacular beauty are actual, real feathers! These fuchsia feathers have been ornately decorated with silver and fuchsia glitter - gorgeous enough to rival a real butterfly! The underside of the wings have a thin coating which holds the feathers in place. The strand is 6.5' long and each butterfly has a wingspan of 5.5" wide by 3" long. They are evenly spaced along the monofiliment strand and there is a loop at the top of the garland and a clear, faceted bead at the bottom. These colors are so vivid and cheerful on these 9 butterflies that you'll want to immediately take them out, hang them and enjoy this glistening, graceful strand!wild-pagehebecu1https://s.yimg.com/aah/shopwildthings/garland-paper-3d-hearts-pink-glitter-44.jpghttps://s.yimg.com/aah/shopwildthings/garland-paper-3d-hearts-pink-glitter-45.jpgwild-pageracost1https://s.yimg.com/aah/shopwildthings/garland-butterflies-colorful-primaries-6-5-feet-long-58.jpghttps://s.yimg.com/aah/shopwildthings/garland-butterflies-colorful-primaries-6-5-feet-long-59.jpgThese adorable butterflies made from real feathers will add life and color wherever they are placed and the hand painted features on the feather wings is to be admired! The wing colors are light yellow, orange, fuchsia, turquoise or red and have contrasting lines and colors for that extra detail! The underside of the wings have a thin coating which holds the feathers in place. The strand has 9 butterflies and is 6.5' long. Each butterfly has a wingspan of 4" wide by 2.5" long. They are evenly spaced along the monofiliment strand and there is a loop at the top of the garland and a clear, faceted bead at the bottom.wild-pageracost1https://s.yimg.com/aah/shopwildthings/garland-butterflies-royal-multicolors-6-5-feet-long-57.jpghttps://s.yimg.com/aah/shopwildthings/garland-butterflies-royal-multicolors-6-5-feet-long-58.jpgThe colors really pop on these gorgeous butterflies and an incredible feature is that the wings are real feathers! The wing colors are light yellow, orange, fuchsia, purple or red and are hand painted with contrasting lines and colors. The underside of the wings have a thin coating which holds the feathers in place. The strand has 9 butterflies and is 6.5' long. Each butterfly has a wingspan of 5.5" wide by 2.5" long. They are evenly spaced along the monofiliment strand and there is a loop at the top of the garland and a clear, faceted bead at the bottom. The detail on these awesome butterflies is remarkable.wild-pagewhclde1https://s.yimg.com/aah/shopwildthings/garland-6-clear-crystal-beads-silver-wire-30.jpghttps://s.yimg.com/aah/shopwildthings/garland-6-clear-crystal-beads-silver-wire-31.jpg5' 6" Crystal Beaded Garland on Thin Silver Wire, Tree, Floral and Table Decoration Use this stunning garland to wrap around candle holders, to enhance floral displays or simply use as sparkling tree garland. Hundreds of crystal clear beads are hand- strung onto bendable silver wire and the crystal covered portion of the garland is 58" long with an additional 8" long plain wire to wrap and secure the garland. Varying length strands sprout from both sides of the main wire for an approx. width of 7", or position the wires in an upright position. Hang in front of a window or mirror for a beautiful, icy effect or use in a table centerpiece or as a table runner.wild-pagegaandst1https://s.yimg.com/aah/shopwildthings/garland-pearls-on-wire-60-strand-of-pearls-and-acrylic-gems-62.jpghttps://s.yimg.com/aah/shopwildthings/garland-pearls-on-wire-60-strand-of-pearls-and-acrylic-gems-63.jpgOur fantastic new pearl garland is strung on wire for an extra-upscale look. You'll love all of the different sizes of large pearls, ranging in size from 1/4" to 3/4" in diameter! Among the pearl beads you'll find some very cool square clear acrylic beads. The end of each strand is finished with a large faceted acrylic drop that is 2" long. Total length 60"wild-pagesilverdecor1https://s.yimg.com/aah/shopwildthings/garland-5-feet-long-metallic-silver-pearls-set-of-2-48.jpghttps://s.yimg.com/aah/shopwildthings/garland-5-feet-long-metallic-silver-pearls-set-of-2-49.jpg]]>wild-pagegolddecor11https://s.yimg.com/aah/shopwildthings/garland-5-feet-long-pack-of-2-gold-brown-pearl-34.jpghttps://s.yimg.com/aah/shopwildthings/garland-5-feet-long-pack-of-2-gold-brown-pearl-35.jpg ]]>wild-pagegaandst11https://s.yimg.com/aah/shopwildthings/garland-5-feet-long-set-of-2-clear-clear-49.jpghttps://s.yimg.com/aah/shopwildthings/garland-5-feet-long-set-of-2-clear-clear-50.jpg ]]>wild-pagegaandst11https://s.yimg.com/aah/shopwildthings/garland-5-feet-long-set-of-2-blue-and-green-35.jpghttps://s.yimg.com/aah/shopwildthings/garland-5-feet-long-set-of-2-blue-and-green-36.jpg ]]>wild-pagegaandst11https://s.yimg.com/aah/shopwildthings/garland-5-feet-long-set-of-2-blue-mist-37.jpghttps://s.yimg.com/aah/shopwildthings/garland-5-feet-long-set-of-2-blue-mist-38.jpg]]>wild-pagegaandst11https://s.yimg.com/aah/shopwildthings/garland-5-feet-long-set-of-2-chocolate-36.jpghttps://s.yimg.com/aah/shopwildthings/garland-5-feet-long-set-of-2-chocolate-37.jpg]]>wild-pagegaandst11https://s.yimg.com/aah/shopwildthings/garland-5-feet-long-set-of-2-ivory-pearl-stones-pearls-38.jpghttps://s.yimg.com/aah/shopwildthings/garland-5-feet-long-set-of-2-ivory-pearl-stones-pearls-39.jpg ]]>wild-pagegaandst11https://s.yimg.com/aah/shopwildthings/garland-5-feet-long-set-of-2-lavender-mist-35.jpghttps://s.yimg.com/aah/shopwildthings/garland-5-feet-long-set-of-2-lavender-mist-36.jpg ]]>wild-pagegaandst11https://s.yimg.com/aah/shopwildthings/garland-5-feet-long-set-of-2-moonstone-white-35.jpghttps://s.yimg.com/aah/shopwildthings/garland-5-feet-long-set-of-2-moonstone-white-36.jpg ]]>wild-pagegaandst11https://s.yimg.com/aah/shopwildthings/garland-5-feet-long-set-of-2-orange-35.jpghttps://s.yimg.com/aah/shopwildthings/garland-5-feet-long-set-of-2-orange-36.jpg ]]>wild-pagegaandst11https://s.yimg.com/aah/shopwildthings/garland-5-feet-long-set-of-2-pearls-garnet-red-iridescent-36.jpghttps://s.yimg.com/aah/shopwildthings/garland-5-feet-long-set-of-2-pearls-garnet-red-iridescent-37.jpg ]]>wild-pagereddecor11https://s.yimg.com/aah/shopwildthings/garland-5-feet-long-set-of-2-red-2-toned-49.jpghttps://s.yimg.com/aah/shopwildthings/garland-5-feet-long-set-of-2-red-2-toned-50.jpg]]>wild-pagegaandst11https://s.yimg.com/aah/shopwildthings/garland-5-feet-long-set-of-2-topaz-pearlized-and-iridescent-34.jpghttps://s.yimg.com/aah/shopwildthings/garland-5-feet-long-set-of-2-topaz-pearlized-and-iridescent-35.jpg ]]>wild-pagewhclde11https://s.yimg.com/aah/shopwildthings/garland-5-feet-long-set-of-2-white-pearl-beaded-35.jpghttps://s.yimg.com/aah/shopwildthings/garland-5-feet-long-set-of-2-white-pearl-beaded-36.jpg ]]>wild-pagegaandst1https://s.yimg.com/aah/shopwildthings/garland-5-feet-long-soft-metallic-gold-pearls-set-of-2-49.jpghttps://s.yimg.com/aah/shopwildthings/garland-5-feet-long-soft-metallic-gold-pearls-set-of-2-50.jpg]]>wild-pagesilkflowersk9-crystal-beaded-garland-strand-small-beadk9-crystal-beaded-garland-strand-large-bead30foloclbest30fololaocga7010030foloovocac30foloffaova30foloaofdiacirclesandsquaresacrylicsquaresemeraldsandsquaresacrylicgarlandreal-glass-crystal-strand-wedding-trees-hawthorn70102froacbagast6circlesacryliccrystalgarlands70106tree-crystals-clear-real-glass-octagons-dinsmorecrystalstrandoctagonscrystalstrandiridescentcrga4fe3coavacgastro1doscleargarlands70104crystalgarlandscirclesglass-crystals-real-glass-squares-baxtoncrystal-prism-strand-set-clear-20inchesacpe4lodsetocrystal-prism-set-of-12-strandsreal-crystal-garland-ornamentcrystal-strand-with-pendant-silverclear-hanging-raindrop-ornamentswedding-tree-crystal-decorationscrystal-hanging-prisms-glass-12pcsglass-crystal-bead-strands-silver-prismsclear-hanging-kite-ornament-setslarge-crystal-hanging-ornamentsreal-crystal-beads-strands-ornamentscrystal-prism-iridescent-strand-setclear-teardrop-beads-hangingreal-crystal-garlands-elizabeth-cleariridescent-real-crystal-garlands-elizabethreal-glass-crystal-garland-silverbutterfly-crystal-strands-real-crystalreal-glass-ball-faceted-crystal-oranamentacgastoc1doslaciandocacgmirror-garland-strand-round-discs-33feetmirror-garland-chain-double-density-circles-33ftmirror-garland-strand-rectangles-33feetmirror-garland-strand-squares-33feetacrylic-garland-strands-12-pcs-fuchsiaacrylic-garland-strands-12-pcs-light-blue1900230fololajetb190031900519004browncrystalgarlandacgastlipidiacgastpuro1dacgastpudi1dacgastfuro1dacgastfudi1dacgastblro1dacgastbldi1dacgastturo1dacgasttudi1dglass-ball-strand-silver-22-inchesglass-teardrop-strand-champagne-22-inchesglass-teardrop-strand-clear-22-inchesglass-teardrop-strand-silver-22-inchespearlgarlandsrolls-of-pearl-beads-crafts-whiterollofpearlsrolls-of-pearl-beads-crafts-ivoryroll-of-pearls-ivory-10mm-66feetdisco-ball-roll-of-beadsroofbe66diduroofbe33ya9droofbe33ya9d2roofbe33ya9froofbe33ya9d1roofbe22ya6dcrystal-beads-roll-iridescent-6mm-ballchainroofbe22ya61roofbe50yadi1roofbe50yaliroofbe60gecr20yds-iridescent-roll-of-beadsroofbe33ya1broofbe33ya99hanging-crystal-balls-clear-12pcs-20mmcrystal-clear-30mm-hanging-ball-dropsfaceted-crystal-balls-40mm-clear-dropslarge-faceted-crystal-ball-pendant-50mm-clearcrystalbeadedgarlandga5felowhbega5felosetof14ga5felosetof12ga5felosetof1ga5felosetof11ga5felosetof5ga5felosetof15ga5felosetof2ga5felopaof25ga5felosetof9ga5felosetof8ga5felosetof17ga5felosetof6ga5felogrpesgaofgl5felopsilverbeadedgarlandstrandgoldbeadedgarlandstrandga5felosetofbecari4pecridiamondbeadremnants272feetaces-eights-crystal-bead-strandsballchain-silver-bead-remnant-strands-12footremnant-bead-strands-crafts-decorations1ballchain-crystal-iridescent-remnantspastel-gypsy-bead-remnantsdriftwood-garland-whitewashed-84inchesdriftwood-garland-natural-84incheswood-slab-garland-faith-hope-love-wooden-slicesdriftwood-garland-with-stonesdrga72drga72lox3mpbirch-ribbon-70inchesbugaglblfubaaqua-silk-roses-flower-garland-8ftcoral-silk-roses-flower-garland-8ftpink-silk-roses-flower-garland-8ftpurple-silk-roses-flower-garland-8ftroyalblue-silk-roses-flower-garland-8ftred-silk-roses-flower-garland-8ftwhite-silk-roses-flower-garland-8ftplumeria-flower-garland-cream-86inchesplumeria-flower-garland-cream-and-pink-91inchesplumeria-garland-cream-double-sided-76inchesplumeria-flower-garland-white-80inches5foot-capiz-shell-strands-magentasparkle-garland-gold-silver-chaintissue-paper-tassel-garlands-8pcs-12inch-whitetissue-paper-tassel-garlands-8pcs-12inch-blackugludaoaaddaugldamaanst11https://s.yimg.com/aah/shopwildthings/beaded-garlands-strands-39.jpghttps://s.yimg.com/aah/shopwildthings/beaded-garlands-strands-40.jpgrolls of beads and beaded pendants that are the perfect garland accompaniments. Plus, everyone who has given us their feedback has one important thing in common: they rave about the quality and how amazing they look.

We have a large inventory of crystal beads that is ready to ship to you quickly and in time for your special event. If you do not see what you are looking for on this page, please call us. One of our professional, knowledgeable team members will be happy to help you find the perfect crystal strands for you.

]]>wild-pagetriangle-pennant-bunting-banner-garlands-butterflies-heartsrollsofbeadsgaandstpeacglgldebahaglgldicofortadiwrroascoanbrbusilk-flower-garlandsbudeitbugachtriangle-pennant-bunting-banner-garlands-butterflies-heartsstline3dglorlahadeflfasecoavgaandstmagneticclasps6x5mmbarrelmagneticclasps12x6mmdoubleballdigoorhosetoglorstofbecatrfatrmidibagldebahaglglacrylic-vs-crystal-beadsirconocobutw1https://s.yimg.com/aah/shopwildthings/garlands-pendants-94.jpghttps://s.yimg.com/aah/shopwildthings/garlands-pendants-95.jpg
Decorate stage sets, outdoor festivals, wedding receptions, bridal showers, birthday parties and anniversary celebrations. Add dazzle to retail window displays or nightclub entrances. Transform an ordinary deck into the setting for a fabulous cocktail party.

Choose our octagon clear beads that are faceted to look like diamonds. Let them cascade from railings, centerpieces or candleholders. To Decorate a wedding tree, one of our customers, a leading event planner, draped the tree with strands of diamond-cut acrylic crystal strands clear crystal acrylic hanging pendants.

We also carry crystal garlands in your choice of clear, red, blue, jet black, pink or purple acrylic beads. Create a solid color theme, or create a mix of colors.

Our collections of acrylic pendants have been purchased for use at formal parties and to Decorate bedrooms in private homes. Each is faceted to produce a prism effect that catches and reflects light. Hang them from wedding arches, centerpieces, candleholders or light fixtures.

Our raindrop-shaped "Miranda" acrylic pendants are available in sets of 24 to hang from wedding trees or chandeliers. Choose tiny clear pendants or larger acrylic pendants in sizes ranging up to 2 inches in diameter. Our real-glass icicle hanging ornaments range in length from 4.75 to 7 inches. Create a special effect with 7.5-inch teardrop ornaments.

We carry charming diamond ring-shaped hanging ornaments and faux mercury glass drop ornaments in antique silver and gold. Choose an elegant pendant with our hanging fleur-de-lis ornaments in silver glitter or gold and champagne glitter. Decorate a centerpiece or entryway with our gold or silver glitter hanging candelabra ornament. It's 16 inches high.

Go retro with our shiny silver hanging disco ball ornaments. You can also order our acrylic crystal pendants available in more than a dozen sheer colors by the 130-piece bag.

• Roll of beads and diamond wrap are great for DIY weddings and special events
• Adjusting the size of crystal garlands and strands is a snap because they're made with removable jump rings
• Crystal pendants are constructed from high-quality acrylic material
• Our Decorative glass balls come in three different sizes: 60 millimeter, 80 millimeter and 100 millimeter