wild-pagepinks11https://s.yimg.com/aah/shopwildthings/diamond-confetti-2000-pcs-1-carat-6-5mm-fuschia-acrylic-diamonds-28.jpghttps://s.yimg.com/aah/shopwildthings/diamond-confetti-2000-pcs-1-carat-6-5mm-fuschia-acrylic-diamonds-29.jpg These are measured at the factory by WEIGHT, so all counts are approximate. Not approximate like you'd be over or under by hundreds, but you might be short or over by a few pcs. We do not count the number of confetti in each bag before shipping.]]>wild-pagedicoforta11https://s.yimg.com/aah/shopwildthings/diamond-confetti-2000-pcs-1-carat-6-5mm-ice-blue-acrylic-diamonds-33.jpghttps://s.yimg.com/aah/shopwildthings/diamond-confetti-2000-pcs-1-carat-6-5mm-ice-blue-acrylic-diamonds-34.jpg These are measured at the factory by WEIGHT, so all counts are approximate. Not approximate like you'd be over or under by hundreds, but you might be short or over by a few pcs. We do not count the number of confetti in each bag before shipping.]]>wild-pagewhclde11https://s.yimg.com/aah/shopwildthings/diamond-confetti-400-pcs-6-carats-12mm-clear-acrylic-diamonds-49.jpghttps://s.yimg.com/aah/shopwildthings/diamond-confetti-400-pcs-6-carats-12mm-clear-acrylic-diamonds-50.jpgAcrylic Diamonds to Scatter on Tables or fill containers! Our incredible little diamonds will add sparkle and class to your table! These are made of ACRYLIC (very high grade) and have the light transmission of glass. Like real diamonds, they are faceted and reflect light beautifully. There is NO foil backing on these, they are a totally 3-D acrylic bead. You can re-use this item again and again! For the photo we took less than a handful of beads to take the photo! You couldn't tell from the package that even one bead had been removed. The point is that these spread out very nicely...you can make a huge impact with little cost! These are measured at the factory by WEIGHT, so all counts are approximate. Not approximate like you'd be over or under by hundreds, but you might be short or over by a few pcs. We do not count the number of confetti in each bag before shipping.wild-pagewhclde11https://s.yimg.com/aah/shopwildthings/diamond-confetti-800-pcs-4-carats-10mm-clear-acrylic-diamonds-41.jpghttps://s.yimg.com/aah/shopwildthings/diamond-confetti-800-pcs-4-carats-10mm-clear-acrylic-diamonds-42.jpg These are measured at the factory by WEIGHT, so all counts are approximate. Not approximate like you'd be over or under by hundreds, but you might be short or over by a few pcs. We do not count the number of confetti in each bag before shipping.]]>dicoforta dibecuwild-pagewhclde11https://s.yimg.com/aah/shopwildthings/diamond-confetti-8000-pcs-1-3-carat-4-5mm-clear-acrylic-diamonds-82.jpghttps://s.yimg.com/aah/shopwildthings/diamond-confetti-8000-pcs-1-3-carat-4-5mm-clear-acrylic-diamonds-83.jpgAcrylic Diamonds to Scatter on Tables or fill containers! Our incredible little diamonds will add sparkle and class to your table! These are made of ACRYLIC (very high grade) and have the light transmission of glass. Like real diamonds, they are faceted and reflect light beautifully. There is NO foil backing on these, they are a totally 3-D acrylic bead. You can re-use this item again and again! For the photo we took less than a handful of beads to take the photo! You couldn't tell from the package that even one bead had been removed. The point is that these spread out very nicely...you can make a huge impact with little cost! How many is 8000? 4 bags of 2,000. Ok Ok, it's a lot! These are measured at the factory by WEIGHT, so all counts are approximate. Not approximate like you'd be over or under by hundreds, but you might be short or over by a few pcs. We do not count the number of confetti in each bag before shipping.wild-pagerewophonmtv11https://s.yimg.com/aah/shopwildthings/diamond-crystal-columns-in-action-26.jpghttps://s.yimg.com/aah/shopwildthings/diamond-crystal-columns-in-action-27.jpgdicrco9fetab dicrcicoco14 dicrco20fetawild-pagewhclde1https://s.yimg.com/aah/shopwildthings/diamond-crystal-sparkling-iridescent-square-column-14-feet-long-premium-quality-beads-76.jpghttps://s.yimg.com/aah/shopwildthings/diamond-crystal-sparkling-iridescent-square-column-14-feet-long-premium-quality-beads-77.jpgtotal hanging length is 15 Feet! The frame at the top is equipped to hold a light kit and light glimmering off the iridescent strands makes a magnificent effect. Add color gels to your lighting and you can pretty much make these appear to be any color you choose or simply place an LED Saucer on the top! Lighting is NOT needed to use this fabulous item, and very often omitted. The hanging chain is removeable and the frame has 8 crossbars so you could hang Crystal Flower Garlands or add more iridescent crystal strands. This column can also sit atop a Floor or Centerpiece Riser and the fabulous beads can pool on the floor or table. The beads are molded onto heavy string so you can cut the strands wherever you'd like and the beads will not fall off. The total hanging weight is approx 11.3 pounds. ]]>becrco acbecu ledlidiupvao exlocuwild-pagerewophonmtv11https://s.yimg.com/aah/shopwildthings/diamond-crystal-tree-40.jpghttps://s.yimg.com/aah/shopwildthings/diamond-crystal-tree-41.jpgA long time customer we super-love, Christine Ridgeway from Empire Designs created this fabulous tree! Christine plans events in Cleveland, New York, Fort Lauderdale and Naples, FL! Photos used with express permission of the copyright owner. Please do not duplicate.catrfatr gaandstwild-pagevaflvaeitocy11https://s.yimg.com/aah/shopwildthings/diamond-shaped-hanging-vases-clear-glass-set-of-6-7-x-3-19.jpghttps://s.yimg.com/aah/shopwildthings/diamond-shaped-hanging-vases-clear-glass-set-of-6-7-x-3-20.jpgRose Petals, colorful diamond confetti, water jelly pearls or colored sand. For those of us with a not-so-green thumb, snippets of Artificial Sprays and dangling leafy vines provide a realistic greenery display without the worry of caring for a live plant (thank-you very much!). These hanging glass diamonds make an awesome addition to any room and it's so easy to do! Hang in staggered lengths with acrylic bead strands, ribbon or monofilament line. We also have a tear drop shaped vase and hanging the 2 together creates a very pleasing visual display! Note: These items are not suitable for International Shipping. We pack so carefully but damages are sometimes unavoidable during transit. Additionally, if damages on glass items do occur, we reserve the right to replace or refund your transaction based on our shipping cost analysis for your order. ]]>vaflvaeitocy ropesiropebs silkflowerswild-pagedibecu1https://s.yimg.com/aah/shopwildthings/silver-diamond-wrap-shopwildthings-24.jpghttps://s.yimg.com/aah/shopwildthings/silver-diamond-wrap-shopwildthings-25.jpgOur new Large Diamond Wrap Roll in shiny silver is bendable crystal mesh that can be trimmed to any length, width or shape that you desire! It looks just like it's covered in sparkling diamonds. It is very easy to work with and add to candles, vases, cake and cupcake stands, around floral arrangements and more. Each roll is 4" wide by 30 ft long and each "diamond" is 1/4" in diameter. This stuff really looks like there are gemstones on top but it's an optical illusion, the "diamonds" are actually concave cut-outs. Great stuff at a great price! You can even save the leftover trimmings and bling out whatever you choose. We've just bedazzled our calculators (and our scissors, and our tape guns, and our measuring tapes....) with some leftovers. FUN FUN FUN! Attach the Diamond Wrap Rolls to your item by using double sided tape, safety pins, glue, thumbtacks...garlands-and-pendants event-decorwild-pageblackdecor1https://s.yimg.com/aah/shopwildthings/diamond-wrap-rolls-black-4-wide-x-30-long-10-yards-trimmable-20.jpghttps://s.yimg.com/aah/shopwildthings/diamond-wrap-rolls-black-4-wide-x-30-long-10-yards-trimmable-21.jpg]]>ugludaoaadda diwrroascoan rollsofbeadswild-pagediwrroascoan11https://s.yimg.com/aah/shopwildthings/diamond-wrap-rolls-champagne-4-wide-x-30-long-10-yards-trimmable-23.jpghttps://s.yimg.com/aah/shopwildthings/diamond-wrap-rolls-champagne-4-wide-x-30-long-10-yards-trimmable-24.jpg ]]>ugludaoaadda diwrroascoan rollsofbeadswild-pageclearance-event-decorations1https://s.yimg.com/aah/shopwildthings/diamond-wrap-rolls-gold-4-wide-x-30-long-10-yards-trimmable-29.jpghttps://s.yimg.com/aah/shopwildthings/diamond-wrap-rolls-gold-4-wide-x-30-long-10-yards-trimmable-30.jpg]]>ugludaoaadda diwrroascoan rollsofbeadswild-pageclshall1https://s.yimg.com/aah/shopwildthings/diamond-wrap-rolls-silver-flowers-4-wide-x-30-long-10-yards-trimmable-50.jpghttps://s.yimg.com/aah/shopwildthings/diamond-wrap-rolls-silver-flowers-4-wide-x-30-long-10-yards-trimmable-51.jpgOur new Diamond Wrap Rolls with Silver flowers are bendable crystal mesh that can be trimmed to any length, width or shape that you desire! It looks just like it's covered in sparkling diamonds. The flowers have fantastic detail and add awesome visual appeal to your project! This wrap is very easy to work with and add to candles, vases, cake and cupcake stands, around floral arrangements and more. Each "diamond" is 1/8" in diameter. Each flower is about 1/2" in diameter. This stuff really looks like there are gemstones on top but it's an optical illusion, the "diamonds" are actually concave cut-outs. Great stuff at a great price! You can even save the leftover trimmings and bling out whatever you choose. We've just bedazzled our calculators (and our scissors, and our tape guns, and our measuring tapes....) with some leftovers. FUN FUN FUN!Attach the Diamond Wrap Rolls to your item by using double sided tape, safety pins, glue, thumbtacks...diwrroascoanwild-pagediwrroascoan11https://s.yimg.com/aah/shopwildthings/diamond-wrap-rolls-apple-green-4-wide-x-30-long-35.jpghttps://s.yimg.com/aah/shopwildthings/diamond-wrap-rolls-apple-green-4-wide-x-30-long-36.jpg ]]>wild-pagebltude1https://s.yimg.com/aah/shopwildthings/diamond-wrap-rolls-aqua-turquoise-blue-4-wide-x-30-long-24.jpghttps://s.yimg.com/aah/shopwildthings/diamond-wrap-rolls-aqua-turquoise-blue-4-wide-x-30-long-25.jpg ]]>ugludaoaadda diwrroascoan rollsofbeadswild-pagerollsofbeads1https://s.yimg.com/aah/shopwildthings/diamond-wrap-rolls-black-silver-4-wide-x-30-long-24.jpghttps://s.yimg.com/aah/shopwildthings/diamond-wrap-rolls-black-silver-4-wide-x-30-long-25.jpg ]]>ugludaoaadda diwrroascoan rollsofbeadswild-pagediwrroascoan1https://s.yimg.com/aah/shopwildthings/diamond-wrap-rolls-fuchsia-pink-4-wide-x-30-long-30.jpghttps://s.yimg.com/aah/shopwildthings/diamond-wrap-rolls-fuchsia-pink-4-wide-x-30-long-31.jpg ]]>ugludaoaadda diwrroascoan rollsofbeadswild-pageorangedecor1https://s.yimg.com/aah/shopwildthings/diamond-wrap-rolls-orange-4-wide-x-30-long-35.jpghttps://s.yimg.com/aah/shopwildthings/diamond-wrap-rolls-orange-4-wide-x-30-long-36.jpgOur new Diamond Wrap Rolls are bendable crystal mesh that can be trimmed to any length, width or shape that you desire! It looks just like it's covered in sparkling diamonds. It is very easy to work with and add to candles, vases, cake and cupcake stands, around floral arrangements and more. Each roll is 4 5/8" wide by 30 ft long and each "diamond" is 1/8" in diameter. This stuff really looks like there are gemstones on top but it's an optical illusion, the "diamonds" are actually concave cut-outs. Great stuff at a great price! You can even save the leftover trimmings and bling out whatever you choose. We've just bedazzled our calculators (and our scissors, and our tape guns, and our measuring tapes....) with some leftovers. FUN FUN FUN! Attach the Diamond Wrap Rolls to your item by using double sided tape, safety pins, glue, thumbtacks...garlands-and-pendants event-decorwild-pagerollsofbeads1https://s.yimg.com/aah/shopwildthings/diamond-wrap-rolls-pink-4-wide-x-30-long-40.jpghttps://s.yimg.com/aah/shopwildthings/diamond-wrap-rolls-pink-4-wide-x-30-long-41.jpgOur Diamond Wrap Rolls are bendable crystal mesh that can be trimmed to any length, width or shape that you desire! It looks just like it's covered in sparkling diamonds. It is very easy to work with and add to candles, vases, cake and cupcake stands, around floral arrangements and more. Each roll is 4 5/8" wide by 30 ft long and each "diamond" is 1/8" in diameter. This stuff really looks like there are gemstones on top but it's an optical illusion, the "diamonds" are actually concave cut-outs. Great stuff at a great price! You can even save the leftover trimmings and bling out whatever you choose. We've just bedazzled our calculators (and our scissors, and our tape guns, and our measuring tapes....) with some leftovers. FUN FUN FUN! Attach the Diamond Wrap Rolls to your item by using double sided tape, safety pins, glue, thumbtacks...garlands-and-pendants event-decorwild-pagerollsofbeads1https://s.yimg.com/aah/shopwildthings/diamond-wrap-rolls-red-4-wide-x-30-long-39.jpghttps://s.yimg.com/aah/shopwildthings/diamond-wrap-rolls-red-4-wide-x-30-long-40.jpgOur new Diamond Wrap Rolls are bendable crystal mesh that can be trimmed to any length, width or shape that you desire! It looks just like it's covered in sparkling diamonds. It is very easy to work with and add to candles, vases, cake and cupcake stands, around floral arrangements and more. Each roll is 4 5/8" wide by 30 ft long and each "diamond" is 1/8" in diameter. This stuff really looks like there are gemstones on top but it's an optical illusion, the "diamonds" are actually concave cut-outs. Great stuff at a great price! You can even save the leftover trimmings and bling out whatever you choose. We've just bedazzled our calculators (and our scissors, and our tape guns, and our measuring tapes....) with some leftovers. FUN FUN FUN! Attach the Diamond Wrap Rolls to your item by using double sided tape, safety pins, glue, thumbtacks...garlands-and-pendants event-decorwild-pagerollsofbeads1https://s.yimg.com/aah/shopwildthings/diamond-wrap-rolls-royal-purple-4-5-8-wide-x-30-long-51.jpghttps://s.yimg.com/aah/shopwildthings/diamond-wrap-rolls-royal-purple-4-5-8-wide-x-30-long-52.jpg
Attach the Diamond Wrap Rolls to your item by using double sided tape, safety pins, glue, thumbtacks...]]>
diwrroascoan garlands-and-pendants event-decor
wild-pagediwrroascoan11https://s.yimg.com/aah/shopwildthings/diamond-wrap-rolls-silver-4-wide-x-30-long-trimmable-32.jpghttps://s.yimg.com/aah/shopwildthings/diamond-wrap-rolls-silver-4-wide-x-30-long-trimmable-33.jpg ]]>ugludaoaadda diwrroascoan rollsofbeadswild-pagediycraftrhdiridiamondwrapgoldred-metallic-diamond-wrappink-diamond-wrap-roll34134diamondwrapblackorange-diamond-wrap-rolllarge-diamonds-silver-wrap-rollsflowersdiamondwraprolls34139chevrondiamondwrapwhitesilverchevrondiamondwrapblacksilver34136royal-purple-diamond-wrap-roll34135greendiamondwrapsilver-poly-deco-mesh-ribbon-25yardsdeco-ribbon-metallic-fuchsia-25ydsmetallic-green-decorating-ribbon-mesh2192276121922762diamondmeshchampagnepearlwraprolltinyrhinestonestickerspearlstickers6mmlavenderrhinstonespurplerhinestonestickersapplegreenrhinestonestickerspinkrhinestonestickersflowersrhinestones20mmstarsrhinestone20mmstarsrhinestone10mmcolorful-rhinestone-flatback-crystals-7mm-roundugludaoaadda10inch-hot-glue-gun-sticks-2lb-bulk-bags2lb-bulk-bags-8inch-hot-glue-gun-sticks1https://s.yimg.com/aah/shopwildthings/diamond-wrap-rolls-adhesive-diamonds-34.jpghttps://s.yimg.com/aah/shopwildthings/diamond-wrap-rolls-adhesive-diamonds-35.jpg Please see the video below showing how easy this product is to use! Buy Diamond Ribbon Wrap from ShopWildThings to ensure timely shipping and excellent quality. Also known as Crystal Mesh, this is a material that can be cut to size and wrapped around floral arrangement, candles, vases and more. Use it over and over again for different applications. ]]>rollsofbeads demeriro4 demeriro2x25 waspgltanome chalkboard-label-stickers-setof36 adhesive-chalkboard-film-large-panelwild-pagedibecu1https://s.yimg.com/aah/shopwildthings/diamonds-9-long-silver-metallic-beaded-curtain-102.jpghttps://s.yimg.com/aah/shopwildthings/diamonds-9-long-silver-metallic-beaded-curtain-103.jpgOur Silver Diamonds Metallic Beaded Curtain features bright and shiny faceted beads that sparkle and shine and shine and shine! You'll be amazed at how bright and beautiful this curtain is. There are 34 strands of beads hanging from one curtain rod. The top of the rod features 2 eyelets for easy hanging. For convenience (while hanging or even customizing) these eyelets slide back and forth on the top of the rod. It seriously takes 2 minutes to hang these up from 2 nails or 2 hooks. This Silver Diamonds Beaded Curtain is 3 Feet Wide and 9 Feet Long, making it perfect for taller spaces! You can also trim the beads if you need them shorter, just grab a pair of scissors! Beaded Curtains are beautiful for using as a backdrop at parties and events, in your home in windows and doorways, and for all types of spaces. You can make them into a room divider by hanging a couple next to each other. You can use them behind a bed to create a headboard. Use Beaded Curtains as photo backdrops. Our "Door Beads" are for so much more than doors!silver-diamond-curtain-12-feet-long dibecu sibecudiwild-pagebrandnewitems11https://s.yimg.com/aah/shopwildthings/diamonds-beaded-curtain-sunset-sparkle-35-x-6-24.jpghttps://s.yimg.com/aah/shopwildthings/diamonds-beaded-curtain-sunset-sparkle-35-x-6-25.jpgdibecu chorredmipop acbecuwild-pagewhclde1https://s.yimg.com/aah/shopwildthings/diamonds-beaded-curtain-bendable-top-crystal-iridescent-3-ft-x-12-ft-95.jpghttps://s.yimg.com/aah/shopwildthings/diamonds-beaded-curtain-bendable-top-crystal-iridescent-3-ft-x-12-ft-96.jpg
This curtain weighs almost 5 lbs. and it comes to you with the strands tied up so they're not tangled. The rod has 4 holes for mounting and you can have this versatile curtain hanging up in just a couple of minutes! Once hanging, the strands are easy to tie back to create a doorway. Each strand is 12" long and the rod is 1" long so the total length is 144". The strands are about 1/4" apart, leaving room for additional strands so if you'd like double density (double the amount of strands) it's not a problem. We do custom orders in-house so just give us a call at 928.855.6075!

Don't let a challenging wall or area get to you - simply grab this curtain with a flexible rod and magnificent beads, hang from the pre-drilled holes, untie the strands, then stand back and admire your cleverness! If you need additional Decor, the beads on this curtain match our other Diamonds Iridescent Curtain, Chandeliers and Columns! Also take a peek at the video below for great tips and ideas on event decorating.
dibecu event-decor
wild-pagewhclde11https://s.yimg.com/aah/shopwildthings/bendable-top-diamonds-beaded-curtain-9-feet-long-48.jpghttps://s.yimg.com/aah/shopwildthings/bendable-top-diamonds-beaded-curtain-9-feet-long-49.jpgWant double-the-strands? No Problem! We love custom orders and do them in-house! Just give us a call at 928.855.6075. Comes with hanging hardware. Just mount it around anything and you've made it custom! The metal rod on the top is bendable, making it perfect to run along walls that are not completely straight, to wrap around other fixtures and objects and more. There are 4 holes in the top so that you can easily secure this curtain. These diamond beaded curtains have an iridescent finish and match our other diamond beaded curtains, chandeliers, columns and more.
diamonds-bendable-top-curtain-crystal-irid-3x6 diamonds-bendable-top-curtain-crystal-irid-3x12 dibecu steelballchaincurtains

The room was anchored by this spectacular chandelier that we created from @shopwildthings1/4Decor Love the idea of putting the tribute videos in screens in the walls. #EventOfTheDay

A photo posted by Colin Cowie (@colincowie) on

We recommend hanging the curtain in place (full length) before removing the ties from the strands. To store your beaded curtains, tie the curtain into sections of strands before taking it down and putting it back in the box. This will make your life SO much easier at events!]]>
dicrcicoco14 dicrco9fetab dicrco20feta gicsw2ti10fe chcch6lo dibeva dicrbecu18lo clgecu dicrbecu9lo roofbe33ya9d ewawasubr60l
wild-pagewhclde11https://s.yimg.com/aah/shopwildthings/diamonds-crystal-beaded-curtain-20-89.jpghttps://s.yimg.com/aah/shopwildthings/diamonds-crystal-beaded-curtain-20-90.jpgThe ShopWildThings Beaded Curtains feature PREMIUM QUALITY acrylic beads. This is not a lightweight knock-off. See the VIDEO below! 35" Wide x 240" Long: Our wonderful heavy-duty acrylic beaded curtains are a perfect addition to any room! Use in the place of regular doors, closet doors, or behind a bed to add height to any room! This clear curtain has an iridescent finish. 32 strands of B-E-A-utiful! Each diamond bead is 1cm in diameter. Hangs on a straight header rod. All beads are attached, just hang it right up using two nails or two small c-hooks. Our matching beaded lamps have the same beads and are also available in this same clear color! We recommend hanging the curtain in place (full length) before removing the ties from the strands. To store your beaded curtains, tie the curtain into sections of strands before taking it down and putting it back in the box. This will make your life SO much easier at events!
clgecu dicrbecu9lo dicrbecu12fe gicsw2ti10fe chcch6lo dicrcicoco14 dicrco9fetab dicrco20feta chdditw beloswla cha2halacr 8folomewabec dicu12wi yadest rrivreworks dibeva roofbe33ya9d incovamchch
wild-pageexlocu1https://s.yimg.com/aah/shopwildthings/diamonds-12-crystal-beaded-curtain-high-gloss-finish-non-iridescent-50.jpghttps://s.yimg.com/aah/shopwildthings/diamonds-12-crystal-beaded-curtain-high-gloss-finish-non-iridescent-51.jpgOur Diamonds Crystal Beaded Curtains are the essential item for adding some shine and class to your wedding, special event, or even to your home Decor! Each of our curtains is made using very high quality acrylic. The beads on this curtain are faceted, making it catch the light so beautifully. Non-Iridescent means that there is no pearlized coating on top of the beads. It is perfectly clear, and very shiny. It is easy to make this curtain appear to be any color too, simply by aiming colored light at it, such as LED lighting. This curtain features 34 strands of beads hanging from one rod. You just take the entire item out of the box and hang it right up in seconds! The rod has 2 eyelets at the top for easy hanging with nails, c-hooks, or our pipe and drape compatible hooks. The eyelets slide back and forth on the top of the rod too which makes making hanging, positioning, and even customizing this curtain a snap! The rod is 35" wide and the strands of beads are 12' long. Each bead is 1cm in diameter and is faceted on both sides, so it is not flat. This beautiful Diamond Beaded Curtain is available from 6 Feet long to 24 Feet long!diamondceilingdrapes diamondbeadedcurtain6feet diamondbeadedcurtain9feet diamondcrystalcurtain12feetlong diamondcrystalbeadedcurtainnoniridescent20foot diamondnon24footwild-pagewhclde1https://s.yimg.com/aah/shopwildthings/diamonds-20-crystal-beaded-curtain-high-gloss-finish-non-iridescent-52.jpghttps://s.yimg.com/aah/shopwildthings/diamonds-20-crystal-beaded-curtain-high-gloss-finish-non-iridescent-53.jpgOur Diamonds Crystal Beaded Curtains are the essential item for adding some shine and class to your wedding, special event, or even to your home Decor! Each of our curtains is made using very high quality acrylic. The beads on this curtain are faceted, making it catch the light so beautifully. Non-Iridescent means that there is no pearlized coating on top of the beads. It is perfectly clear, and very shiny. It is easy to make this curtain appear to be any color too, simply by aiming colored light at it, such as LED lighting. This curtain features 34 strands of beads hanging from one rod. You just take the entire item out of the box and hang it right up in seconds! The rod has 2 eyelets at the top for easy hanging with nails, c-hooks, or our pipe and drape compatible hooks. The eyelets slide back and forth on the top of the rod too which makes making hanging, positioning, and even customizing this curtain a snap! The rod is 35" wide and the strands of beads are 20' long. Each bead is 1cm in diameter and is faceted on both sides, so it is not flat. This beautiful Diamond Beaded Curtain is available from 6 Feet long to 24 Feet long!diamondceilingdrapes diamondbeadedcurtain6feet diamondbeadedcurtain9feet diamondcrystalcurtain12feetlong diamondcrystalbeadedcurtainnoniridescent20foot diamondnon24footwild-pagewhclde1https://s.yimg.com/aah/shopwildthings/diamonds-beaded-curtain-crystal-non-iridescent-3-x-24-106.jpghttps://s.yimg.com/aah/shopwildthings/diamonds-beaded-curtain-crystal-non-iridescent-3-x-24-107.jpg24 Foot Long Diamonds Crystal Beaded Curtain with 34 Totally Clear Strands Our Diamonds Crystal Beaded Curtains are the essential item for adding some shine and class to your wedding, special event, or even to your home decor! Each of our curtains is made using very high quality acrylic. The beads on this curtain are faceted, making it catch the light so beautifully. Non-Iridescent means that there is no pearlized coating on top of the beads. It is perfectly clear, and very shiny. It is easy to make this curtain appear to be any color too, simply by aiming colored light at it, such as LED lighting. The strands can be cut to any length without damaging the curtain or let the sparkling diamonds pool on the floor! This curtain features 34 strands of beads hanging from one rod. You just take the entire item out of the box and hang it right up in seconds! The rod has 2 eyelets at the top for easy hanging with nails, c-hooks, or our pipe and drape compatible hooks. The eyelets slide back and forth on the top of the rod too which makes making hanging, positioning, and even customizing this curtain a snap! This sturdy rod is 35" wide by 1.5" high and the strands of beads are 24' long. Each bead is 1cm in diameter and is faceted on both sides, so it is not flat. This beautiful Diamond Beaded Curtain is available from 6 Feet long to 24 Feet long!diamondceilingdrapes diamondbeadedcurtain6feet diamondbeadedcurtain9feet diamondcrystalcurtain12feetlong diamondcrystalbeadedcurtainnoniridescent20foot diamondnon24footwild-pagewhclde1https://s.yimg.com/aah/shopwildthings/diamonds-6-crystal-beaded-curtain-high-gloss-finish-non-iridescent-44.jpghttps://s.yimg.com/aah/shopwildthings/diamonds-6-crystal-beaded-curtain-high-gloss-finish-non-iridescent-45.jpgCrystal Clear Diamonds Beaded Curtain Backdrop for Wedding and Event Decor (and homes, too!)...3 Feet Wide x 6 Feet Long Our Diamonds Crystal Beaded Curtains are the essential item for adding some shine and class to your wedding, special event, or even to your home Decor! Each of our curtains is made using very high quality acrylic. The beads on this curtain are faceted, making it catch the light so beautifully. Non-Iridescent means that there is no pearlized coating on top of the beads. It is perfectly clear, and very shiny. It is easy to make this curtain appear to be any color too, simply by aiming colored light at it, such as LED lighting. This curtain features 34 strands of beads hanging from one rod. You just take the entire item out of the box and hang it right up in seconds! The rod has 2 eyelets at the top for easy hanging with nails, c-hooks, or our pipe and drape compatible hooks. The eyelets slide back and forth on the top of the rod too which makes making hanging, positioning, and even customizing this curtain a snap! The rod is 35" wide and the strands of beads are 6' long. Each bead is 1cm in diameter and is faceted on both sides, so it is not flat. This beautiful Diamond Beaded Curtain is available from 6 Feet long to 24 Feet long!diamondceilingdrapes diamondbeadedcurtain9feet diamondcrystalcurtain12feetlong diamondcrystalbeadedcurtainnoniridescent20foot diamondnon24footwild-pageexlocu1https://s.yimg.com/aah/shopwildthings/diamonds-9-crystal-beaded-curtain-high-gloss-finish-non-iridescent-41.jpghttps://s.yimg.com/aah/shopwildthings/diamonds-9-crystal-beaded-curtain-high-gloss-finish-non-iridescent-42.jpg
Our how-to video demonstrates just how easy and fast it is to hang your beaded curtain.

Each diamond-cut acrylic bead curtain has 34 strands of crystal beads hanging from one rod. Two eyelets on the top rail make it easy to hang in just a minute or two with two nails, C-hooks or our pipe-and-drape compatible hooks. Because the eyelets slide across the top of the road, it's simple to reposition or customize your curtain. Non-iridescent beads don't have a pearlized coating, which makes them ultra-clear and shiny. Each bead is 12mm (about 1/2 inch) in diameter.

Add a beautiful look to weddings, stage sets, outdoor celebrations, catered dinners and music video backdrops. One customer used our faceted clear crystal curtain to separate her show window from the main body of her lovely boutique. Transform your crystal bead curtains into multi-color light shows with our remote-control lighting systems that change light colors. Our diamond-beaded curtain is also available in lengths ranging from 6 feet to 24 feet.

diamondceilingdrapes diamondbeadedcurtain6feet diamondbeadedcurtain9feet diamondcrystalcurtain12feetlong diamondcrystalbeadedcurtainnoniridescent20foot diamondnon24foot
wild-pageexlocu1https://s.yimg.com/aah/shopwildthings/diamonds-9-light-gold-metallic-beaded-curtain-54.jpghttps://s.yimg.com/aah/shopwildthings/diamonds-9-light-gold-metallic-beaded-curtain-55.jpggold-diamond-bead-curtain-12-feet golddiamondcurtainslightgold golddecor dibecuwild-pageacbecu11https://s.yimg.com/aah/shopwildthings/diamonds-pink-beaded-curtain-33.jpghttps://s.yimg.com/aah/shopwildthings/diamonds-pink-beaded-curtain-34.jpgWe have TWO lamps that match this fantastic beaded curtain! The "Chelsea" (4 feet long) and The "Ashley" (14" long, used in Extreme Makeover Home Edition). You can view and purchase them by going to the Lamps, Chandeliers, Lighting section of our site!]]>chc4swpi cha2halapiwild-pagebecuhastbe111https://s.yimg.com/aah/shopwildthings/diamonds-curtain-12-wide-x-6-long-double-density-27.jpghttps://s.yimg.com/aah/shopwildthings/diamonds-curtain-12-wide-x-6-long-double-density-28.jpg ]]>dibeva chdditw beloswla cha2halacr gicsw2ti10fe dicrcicoco14 clgecuwild-pageexlocu1https://s.yimg.com/aah/shopwildthings/diamonds-beaded-curtain-light-gold-3-x-12-53.jpghttps://s.yimg.com/aah/shopwildthings/diamonds-beaded-curtain-light-gold-3-x-12-54.jpgOur Glamorous Diamonds Gold Beaded Curtain takes glitzy to a new level and is the hot color for decorating! This 12' long Metallic Gold curtain is ideal for all kinds of venues like weddings, anniversaries and holiday parties. Here we offer a "Soft Gold" which is a nicer (we think) color of Metallic Gold that looks much richer and more elegant than standard Gold Metallic finishes can sometimes look. It's the perfect accent color to add style and dazzle to any setting. This curtain matches our 6' and 9' Diamonds Metallic Gold Curtains and for extra color and shine, mix this with our Diamonds Metallic Silver Curtains in 6', 9' or 12' lengths. We use a time consuming triple-dip paint process that ensures beautiful coverage on the beads. The ShopWildThings Gold Beaded Curtain is 3 Feet Wide and 12 Feet Long. There are 34 Strands of beads hanging from one rod. The strands are already hanging inside of the rod, so you just take the curtain out of the box and hang it right up in seconds. At the top of each rod are two eyelets for easy hanging using hooks or nails. The hanging eyelets slide back and forth on the rod on top, making it very easy to hang your curtain, and also easy to customize them when necessary!golddiamondscurtain12feetlong golddiamondcurtainslightgoldwild-pagebendablerod1https://s.yimg.com/aah/shopwildthings/wedding-backdrop-crystal-curtains-64.jpghttps://s.yimg.com/aah/shopwildthings/wedding-backdrop-crystal-curtains-65.jpg
Each diamond-cut beaded curtain has 34 strands and each strand is 12' long. The rod pocket is 35 5/8" wide by 4" deep so the total length of this curtain is 12' 4"! The pocket is specially designed with 34 tiny tabs that are hidden from view and are used to hold the jump rings from which the bead strands hang. The beads are 7/16" wide (just shy of 1/2") and they have a pearlized coating which makes them absolutely gorgeous and even more so when light dances off them. Please watch the short video below to see how beautifully these crystals capture the light and produce a magical shimmery show! The sheen on the satin rod pocket goes perfectly with the beads and the pocket is lined which adds strength. All the edges are neatly finished, making this curtain event ready and wedding worthy!

Add instant glam to weddings, special events, stage sets, outdoor celebrations, event tents, store windows, or use as a photo, video or head table backdrop! Add pizazz to a wall, window, doorway or use as a room divider. If your venue has a curved wall or you want to hang this around a corner, no problem! Use traditional curtain rods, curvy or wavy rods, tension spring rods, telescoping curtain rods, swing arm curtain rods, pipes, poles or wire! This flexible fabric pocket allows you to scrunch the curtain together to accommodate smaller areas or to create a fuller look. If you'd prefer a dazzling Crystal Column, no problem! Add as many curtains to the rod as you need for your taste and application. we're here to help make your vision a reality and we can help with hard to decorate areas!

See how a stage set designer (and also a brilliant ShopWildThings customer!) used beaded curtains to create an amazing chandelier! This versatile satin top diamond-beaded curtain weighs 4.2 lbs. and is also available in 6', 9' and 20'. If you need a shorter length, these diamond strands can be cut at any length you choose.]]>
acbecu becedr cubemerodcuc
wild-pagebendablerod1https://s.yimg.com/aah/shopwildthings/crystal-beaded-curtains-fabric-top-62.jpghttps://s.yimg.com/aah/shopwildthings/crystal-beaded-curtains-fabric-top-63.jpgPlease note that a few additional days are required for fabrication. These Rod Pocket Topped Beaded Curtains are perfect for use with Pipe and Drape systems or any type of curtain rod that you may already have. The opening on the top was made to accommodate both large and small diameter poles. If you've been waiting for a flexible solution for hard to decorate spaces, you're gonna love our new 20 Foot Long Diamonds Crystal Iridescent Beaded Curtains with a Satin Rod Pocket! Classy, exquisite and now more versatile than ever, our Diamonds Crystal Beaded Curtains are known for their quality and for adding tons of sparkle as the faceted acrylic crystal beads capture and reflect light so we're very proud to add this new style which features a large, satin rod pocket! Now, you can enjoy the freedom to hang this glamorous curtain anywhere you want with the confidence that your event decor looks spectacular! You can simply staple this curtain to a secure structure or using any type of rod and drapery hanging system, including wire, install this curtain just like any other panel and the added glimmer of the iridescent beads make this decorative curtain chic and swanky!

Each diamond-cut beaded curtain has 34 strands and each strand is 20' long. The rod pocket is 35 5/8" wide by 4" deep so the total length of this curtain is 20' 4"! The pocket is specially designed with 34 tiny tabs that are hidden from view and are used to hold the jump rings from which the bead strands hang. The beads are 7/16" wide (just shy of 1/2") and they have a pearlized coating which makes them absolutely gorgeous and even more so when light dances off them. Please watch the short video below to see how beautifully these crystals capture the light and produce a magical shimmery show! The sheen on the satin rod pocket goes perfectly with the beads and the pocket is lined which adds strength. All the edges are neatly finished, making this curtain event ready and wedding worthy!

Add instant glam to weddings, special events, stage sets, outdoor celebrations, event tents, store windows, or use as a photo, video or head table backdrop! Add pizazz to a wall, window, doorway or use as a room divider. If your venue has a curved wall or you want to hang this around a corner, no problem! Use traditional curtain rods, curvy or wavy rods, tension spring rods, telescoping curtain rods, swing arm curtain rods, pipes, poles or wire! This flexible fabric pocket allows you to scrunch the curtain together to accommodate smaller areas or to create a fuller look. If you'd prefer a dazzling Crystal Column, no problem! Add as many curtains to the rod as you need for your taste and application. we're here to help make your vision a reality and we can help with hard to decorate areas!

See how a stage set designer (and also a brilliant ShopWildThings customer!) used beaded curtains to create an amazing chandelier! This versatile satin top diamond-beaded curtain weighs 7.1 lbs. and is also available in 6', 9' and 12'. If you need a shorter length, these diamond strands can be cut at any length you choose.]]>
acbecu cubemerodcuc becedr
Each diamond-cut beaded curtain has 34 strands and each strand is 6' long. The rod pocket is 35 5/8" wide by 4" deep so the total length of this curtain is 6' 4"! The pocket is specially designed with 34 tiny tabs that are hidden from view and are used to hold the jump rings from which the bead strands hang. The beads are 7/16" wide (just shy of 1/2") and they have a pearlized coating which makes them absolutely gorgeous and even more so when light dances off them. Please watch the short video below to see how beautifully these crystals capture the light and produce a magical shimmery show! The sheen on the satin rod pocket goes perfectly with the beads and the pocket is lined which adds strength. All the edges are neatly finished, making this curtain event ready and wedding worthy!

Add instant glam to weddings, special events, stage sets, outdoor celebrations, event tents, store windows, or use as a photo, video or head table backdrop! Add pizazz to a wall, window, doorway or use as a room divider. If your venue has a curved wall or you want to hang this around a corner, no problem! Use traditional curtain rods, curvy or wavy rods, tension spring rods, telescoping curtain rods, swing arm curtain rods, pipes, poles or wire! This flexible fabric pocket allows you to scrunch the curtain together to accommodate smaller areas or to create a fuller look. If you'd prefer a dazzling Crystal Column, no problem! Add as many curtains to the rod as you need for your taste and application. we're here to help make your vision a reality and we can help with hard to decorate areas!

See how a stage set designer (and also a brilliant ShopWildThings customer!) used beaded curtains to create an amazing chandelier! This versatile satin top diamond-beaded curtain weighs 2.3 lbs. and is also available in 9', 12' and 20'. If you need a shorter length, these diamond strands can be cut at any length you choose.]]>
acbecu cubemerodcuc curtains-and-columns
Each diamond-cut beaded curtain has 34 strands and each strand is 9' long. The rod pocket is 35 5/8" wide by 4" deep so the total length of this curtain is 9' 4"! The pocket is specially designed with 34 tiny tabs that are hidden from view and are used to hold the jump rings from which the bead strands hang. The beads are 7/16" wide (just shy of 1/2") and they have a pearlized coating which makes them absolutely gorgeous and even more so when light dances off them. Please watch the short video below to see how beautifully these crystals capture the light and produce a magical shimmery show! The sheen on the satin rod pocket goes perfectly with the beads and the pocket is lined which adds strength. All the edges are neatly finished, making this curtain event ready and wedding worthy!

Add instant glam to weddings, special events, stage sets, outdoor celebrations, event tents, store windows, or use as a photo, video or head table backdrop! Add pizazz to a wall, window, doorway or use as a room divider. If your venue has a curved wall or you want to hang this around a corner, no problem! Use traditional curtain rods, curvy or wavy rods, tension spring rods, telescoping curtain rods, swing arm curtain rods, pipes, poles or wire! This flexible fabric pocket allows you to scrunch the curtain together to accommodate smaller areas or to create a fuller look. If you'd prefer a dazzling Crystal Column, no problem! Add as many curtains to the rod as you need for your taste and application. we're here to help make your vision a reality and we can help with hard to decorate areas!

See how a stage set designer (and also a brilliant ShopWildThings customer!) used beaded curtains to create an amazing chandelier! This versatile satin top diamond-beaded curtain weighs 3.3 lbs. and is also available in 6', 12' and 20'. If you need a shorter length, these diamond strands can be cut at any length you choose.]]>
acbecu cubemerodcuc curtains-and-columns
wild-pagedibecu11https://s.yimg.com/aah/shopwildthings/diamonds-beaded-curtain-bendable-top-smoke-gray-iridescent-35-x-9-20.jpghttps://s.yimg.com/aah/shopwildthings/diamonds-beaded-curtain-bendable-top-smoke-gray-iridescent-35-x-9-21.jpgBendable Rod Diamonds Beaded Curtain, Smoke Gray Iridescent Beads on a Flexible Header Rod, 35"W x 9'L Door, Window, Wall or Column Sparkling Accent Decor You'll love the look of this awesome Gray Diamond Beaded Curtain with a pearly iridescent coating that beautifully reflects the light from the perfect facets of the beads! This fabulous curtain is 35" wide by 9' long and comes on a flexible metal headrail with 4 precut holes for hanging. This curtain can curve around pillars, columns and it's perfect for walls that aren't completely straight. There are 34 strands of yummy beads that are fused to the strands, so you can shorten this curtain without fear of damaging it. This curtain weighs 3.8 lbs. Our wonderful heavy-duty acrylic diamonds beaded curtains are a wonderful, refreshing addition to any room and can be used in place of regular doors, closet doors or behind a bed to add the illusion of height to any room! Hang over a window and the sparkling diamonds come alive while giving an open, airy look versus traditional window coverings.dibecu betopdibecu bendablerodwild-pageacbecu11https://s.yimg.com/aah/shopwildthings/diamonds-blues-n-greens-beaded-curtain-80.jpghttps://s.yimg.com/aah/shopwildthings/diamonds-blues-n-greens-beaded-curtain-81.jpgThese diamond cut multi-faceted beads on this blues/greens beaded curtain absolutely sparkle when the sun shines on them! 35" Wide x 70" Long: Our wonderful heavy-duty acrylic beaded curtains are a perfect addition to any room! Use in the place of regular doors, closet doors, or behind a bed to add height to any room! This curtain has a non-iridescent finish. 34 strands of B-E-A-utiful!mawigeandalwild-pagevihowtoswfao11https://s.yimg.com/aah/shopwildthings/diamonds-crystal-9feet-beaded-curtain-shopwildthings-47.jpghttps://s.yimg.com/aah/shopwildthings/diamonds-crystal-9feet-beaded-curtain-shopwildthings-48.jpgThe ShopWildThings Beaded Curtains feature PREMIUM QUALITY acrylic beads. This is not a lightweight knock-off. You've seen our diamond curtains on CSI, Jimmy Kimmel Live, in "The Holiday" feature film starring Cameron Diaz, Jude Law, and Kate Winslet as well as many other projects. This curtain is a favorite of designers in every venue: movies, television, special events, weddings and the home. THAT'S WHY WE KEEP HUNDREDS OF CURTAINS IN STOCK FOR IMMEDIATE DELIVERY! 35" Wide x 108" Long: Our wonderful heavy-duty acrylic beaded curtains are a perfect addition to any room! Use in the place of regular doors, closet doors, or behind a bed to add the look of height to any room! This clear curtain has an iridescent finish. 34 strands of B-E-A-utiful! Each diamond bead is 1cm in diameter. Hangs on a straight header rod. All beads are attached, just hang it right up using two nails or two small c-hooks. Our matching beaded lamps have the same beads and are also available in this same clear color!
clgecu ddubeculbe dicrbecu12fe dicrbecu18lo gicsw2ti10fe chcch6lo dicrcicoco14 dicrco9fetab dicrco20feta chdditw beloswla cha2halacr roofbe33ya9d 8folomewabec dicu12wi yadest rrivreworks dibeva incovamchch
We're not exaggerating when we say how much our customers love these diamond crystal iridescent diamond-faceted crystal bead curtains from ShopWildThings. Scroll through all the rave reviews in the customer testimonials at the bottom of this page about these 6-foot-long acrylic crystal strands curtains.

Shop our magnificent beaded lamps with the same iridescent color and our coordinating accessories to complete your perfectly matched look for that next memorable project. We carry beautiful coordinating chandeliers with crystal beads that sparkle like diamonds and dazzling ceiling canopies with diamond-bright faceted crystals.

Our crystal Celebration Chelsea chandelier is 6 feet in length. Our Falling Stars chandelier is 21.5 inches tall. Our pretty Quinn chandelier is 10 inches in diameter and 21 inches high. Our crystal diamond-faceted beaded ceiling curtains have easy-to-follow instructions for two-person installation.

Buy diamond-look crystal beads by the bag. Each strand is 150 feet long. Our dozens of coordinating items included Room in a Box sets for the bedroom with the same crystals beads on curtains included with bed net canopies and matching hanging lights.

The gorgeous diamond crystal curtains featured on this page with strands of diamond-faceted iridescent beads have been featured on television shows like CSI: Crime Scene Investigation and Jimmy Kimmel Live. They're a favorite for movie productions, weddings, homes, special events and professional photo shoots, too.

Our video on this page demonstrates how beautifully these crystals capture the light for a shimmering look.
dibecu dicrbecu9lo dicrbecu12fe dicrbecu18lo dicrbecu24lo 8folomewabec diamonds-bendable-top-curtain-crystal-irid-3x6 betopdibecu diamonds-bendable-top-curtain-crystal-irid-3x12 diamondcrystalcurtain12feetlong
wild-pageacbecu1https://s.yimg.com/aah/shopwildthings/diamonds-6-light-gold-metallic-beaded-curtain-53.jpghttps://s.yimg.com/aah/shopwildthings/diamonds-6-light-gold-metallic-beaded-curtain-54.jpgGold Diamonds Metallic Sparkly Beaded Curtain Backdrop Decoration for Parties and Special Events 3 Feet Wide x 6 Feet Long. Our Fabulous Metallic Finishes take the Beaded Curtain and turn up the bling a few notches! Gold is a hot color for decorating all kinds of venues like Weddings and Events and is even becoming a hot accent color for the home! Here we offer a "Soft Gold" which is a nicer (we think) color of Metallic Gold that looks much richer and elegant than standard Gold Metallic finishes can sometimes look. We use a time consuming triple-dip paint process that ensures beautiful coverage on the bead. Gold Beaded Curtain is 3 Feet Wide and 6 Feet Long. There are 34 Strands of beads hanging from one rod. The strands are already hanging inside of the rod, so you just take the curtain out of the box and hang it right up in seconds. At the top of each rod are two eyelets for easy hanging using hooks or nails. The hanging eyelets slide back and forth on the rod on top, making it very easy to hang your curtain, and also easy to customize them when necessary!golddecor gold-diamond-bead-curtain-12-feet golddiamondscurtain12feetlong dibecuwild-pageexlocu1https://s.yimg.com/aah/shopwildthings/metallic-silver-beaded-curtains-very-long-34.jpghttps://s.yimg.com/aah/shopwildthings/metallic-silver-beaded-curtains-very-long-35.jpgOur Silver Diamonds Metallic Beaded Curtain now comes in a 12' length and features bright and shiny faceted beads that sparkle and shine and shine and shine! You'll be amazed at how bright and beautiful this curtain is. There are 34 strands of beads hanging from one curtain rod. The top of the rod features 2 eyelets for easy hanging. For convenience (while hanging or even customizing) these eyelets slide back and forth on the top of the rod. It seriously takes 2 minutes to hang these up from 2 nails or 2 hooks. This Silver Diamonds Beaded Curtain is 3 Feet Wide and 12 Feet Long, making it ideal for tall ceilings and larger spaces! You can also trim the beads if you need them shorter or if you'd prefer a scalloped design - just grab a pair of scissors! This curtain matches perfectly with our 6' and 9' long curtains. Create a gorgeous display by staggering the 3 different sizes one in front of the other - STUNNING! Beaded Curtains are beautiful for using as a backdrop at parties, events or window displays and in your home on walls, doorways and for all types of spaces. You can make them into a room divider by hanging a couple next to each other or use them behind a bed to create a headboard. Use Beaded Curtains as photo backdrops. Our "Door Beads" are for so much more than doors!silver9footdiamondscurtains sibecudi chc4swsi roofbe33ya9d1 dibecuwild-pageacbecu11https://s.yimg.com/aah/shopwildthings/diamonds-pinks-n-purples-beaded-curtain-97.jpghttps://s.yimg.com/aah/shopwildthings/diamonds-pinks-n-purples-beaded-curtain-98.jpgThese diamond cut multi-faceted beads on this pinks and purples beaded curtain absolutely sparkle when the sun shines on them! 35" Wide x 70" Long: Our wonderful heavy-duty acrylic beaded curtains are a perfect addition to any room! Use in the place of regular doors, closet doors, or behind a bed to add height to any room! This curtain has a non-iridescent finish. 34 strands of B-E-A-utiful!ch3tiapupibawild-pageacbecu11https://s.yimg.com/aah/shopwildthings/diamonds-silver-beaded-curtain-as-seen-in-dreamgirls-114.jpghttps://s.yimg.com/aah/shopwildthings/diamonds-silver-beaded-curtain-as-seen-in-dreamgirls-115.jpg35" Wide, 72" long...34 strands hanging from one white rod. Already strung and ready to hang up! Beautiful Silver Acrylic Diamonds! This fabulous Silver Diamond beaded curtain has faceted beads. You'll be thrilled with the way that it picks up the light and sparkles no matter which way the beads hang! This Diamond Cut curtain is a favorite for our designers for events and music videos because of this "sparkle factor". We have a lot of customers who put these in front of regular curtain panels. Our wonderful heavy-duty acrylic beaded curtains are a perfect addition to any room! Use in the place of regular doors, closet doors, or behind a bed to add height to any room! B-E-A-utiful!roofbe33ya9d1 silver-diamond-curtain-12-feet-long silver9footdiamondscurtains chc4swsi sidich silverhoopsnewwild-pageacbecu11https://s.yimg.com/aah/shopwildthings/diamonds-beaded-curtain-smoke-grey-31.jpghttps://s.yimg.com/aah/shopwildthings/diamonds-beaded-curtain-smoke-grey-32.jpgThis fantastic color has NO iridesecent coating on top. 35" Wide x 70" Long: Our wonderful heavy-duty acrylic beaded curtains are a perfect addition to any room! Use in the place of regular doors, closet doors, or behind a bed to add the look of height to any room! 34 strands of B-E-A-utiful! Each diamond bead is 1cm in diameter. Hangs on a straight header rod. All beads are attached, just hang it right up using two nails or two small c-hooks.wild-pagerewophonmtv11https://s.yimg.com/aah/shopwildthings/diamonds-beaded-curtains-and-columns-bedroom-transformation-48.jpghttps://s.yimg.com/aah/shopwildthings/diamonds-beaded-curtains-and-columns-bedroom-transformation-49.jpgOur friend Alyce from over at CiaoBella50.com shared images of the transformation she created using our Diamond Beaded Curtains and Diamonds Columns! STUNNING! We LOVE LOVE LOVE it, and love her. We have many upcoming projects coming up with Alyce, stay tuned!dicrco9fetab clgecuwild-pageaccusobystbeaded-curtain-iridescent-diamonds-6ftclgecudicrbecu9lodicrbecu12fedicrbecu18lodicrbecu24lodiamond-beaded-curtain-satin-top-6footdiamond-beaded-curtain-satin-top-9footdiamond-beaded-curtain-satin-top-12footdiamond-beaded-curtain-satin-top-20foot8folomewabeccubemerodcuclarge-diamonds-iridescent-curtain-12-feet-longdiamonds-bendable-top-curtain-crystal-irid-3x6betopdibecudiamonds-bendable-top-curtain-crystal-irid-3x12iridescent-gray-diamonds-beaded-curtain-9ftreal-k9-crystals-beaded-curtaincrystal-beaded-curtain-valance-42wide-ritzy-swagdiamond-drape-with-two-rodsdiamondbeadedcurtain6feetdiamondbeadedcurtain9feetdiamondcrystalcurtain12feetlongdiamondcrystalbeadedcurtainnoniridescent20footdiamondnon24footsibecudisilver9footdiamondscurtainssilver-diamond-curtain-12-feet-longgolddiamondcurtainslightgoldgolddiamondscurtain12feetlonggold-diamond-bead-curtain-12-feetdiamonds-curtain-yellowgold-6feetdiamonds-curtain-yellowgold-9feetbeadedcurtaingraydiamondsddulabesmbecddurobrbecundduchnobecuddupiirbecuddulabepuirbdiduolabebrsdipibecupurplediamondspinpudidiblbecudibecusmgrblackgemcutdibecusoblblandgrdidiamonds-acrylic-beaded-curtain-sunset-sparklediredbecubrbecuclno3xdibevadducrnobeculargediamondscurtains9footshinylargediamondcurtains12feetlongdiamanteduocrystalcurtain20feetlong24footlongcurtaindiamanteled-lighted-sparkle-crystal-curtainsdiamondceilingdrapesled-fairy-lights-ceiling-drape-with-beadsledceilingdrapeswithbeadsceiling-drape-iridescent-crystal-beads-warm-lediridescent-crystal-beaded-ceiling-drapedicrco9fetabdiamonds-iridescent-beaded-column-12feet-longdicrcicoco14dicrco20fetahanging-crystal-beaded-square-column-9ftlong9footcrystalcolumnsquare14footcrystalcolumnsquarecrystal-beaded-square-hanging-column-20ft20footcrystalcolumnsquarecrystal-hanging-column-beaded-strands-large-event-decoracandei3fowidicu12wicrystal-diamondcut-square-chandeliercrystal-diamondcut-cascade-chandelierb4tiacdichcrystal-diamondcut-swag-chandeliercrystal-iridescent-diamond-4tier-chandelier-6ftk9crystal-beaded-chandelier-antique-slvr-20inchantique-silver-real-k9crystal-chandelier-31inchchdditwbeloswlachc4swpichc4swblchc4swpuchc4swsichcch6logicsw2ti10fechhu4timcr72crystal-diamondcut-spiral-chandeliercrystal-diamondcut-spiral-chandelier-4footcrystal-diamondcut-spiral-chandelier-6foot19093chfstclnobechfst21clnobcrystal-diamondcut-3tier-chandelier19014chdiduodcrchbediduodbrchddiduobrsichddiduocrirchandelier3tiercrystalwhitneycrystalbeadedchandelierlargesilverbeadedchandelierlargechsetacrirdichsetasididulargeeventchandelierchandelier2crystal-beaded-chandelier-tabletop-sphere-7inches190091901019011crystal-beaded-card-money-box-silver-13inchescrystal-beads-hanging-votive-holder-silver-6inchescrystal-beads-hanging-candle-holder-silver-1footcrystal-beads-hanging-candle-holder-silver-14inchcrystal-beaded-5cup-candelabra-26inch-silverlacy-silver-crystal-beaded-candelabra-29inchescrystal-beaded-5cup-candelabra-silver-29inchcrystal-beaded-candelabra-silver-5arm-29inch-tallcrystal-beaded-candelabra-silver-13arm-38inchescrystal-beaded-candelabra-silver-5arm-56inchesround-crystal-beaded-candle-stand-13inchescrystal-beaded-silver-crown-candle-holder-9inchreal-crystal-beaded-votive-candle-holdercrystal-beaded-votive-holder-4-inchescrystal-beaded-votive-holder-pillar-6-inchescrystal-beaded-candle-holder-pillar-10inch-silvercylinder-vase-real-crystal-beaded-16inch-silvercrystal-beaded-trumpet-vase-23inch-silvercrystal-beaded-hurricane-vase-silver-37inchescrystal-beaded-tulip-candle-holder-11inchescrystal-beads-sparkly-candle-holder-tulipreal-crystal-beads-tall-centerpieceselegant-crystal-beaded-candle-holdercrystal-beaded-tulip-candle-holder-18inch-silvercrystal-beaded-tulip-candle-holder-19inch-silvercrystal-beaded-candle-holder-9-inch-gobletcrystal-beaded-candle-holders-21-inches-silver-basesparkle-crystal-beaded-candle-holder-15-inches-tallcrystal-goblet-29-inch-candle-holdertall-crystal-beaded-candle-holder-goblet-37-inchestall-crystal-beaded-goblet-candleholder-setcrystal-beaded-goblet-candle-set-etched-silverround-crystal-beaded-votive-holder-3-inchesround-crystal-beaded-votive-holder-4-inchesround-crystal-beaded-votive-candle-holders-5-inchcrystal-beaded-candle-holder-silver-10inchescrystal-beaded-goblet-candle-holder-set-charcoalmermaid-crystal-beaded-goblet-black-23inchesgold-crystals-cake-standcrystal-beaded-chandelier-centerpiece-gold-2ftcrystal-beaded-pedestal-gold-27inchesgold-crystal-centerpiece-risergold-floral-riser-with-crystalscrystal-beaded-card-money-box-gold-13inchescrystal-beaded-hanging-candle-holder-gold-7inchescrystal-beaded-wedding-candle-holderscrystal-beaded-candle-holder-large-tulipcrystal-beaded-tulip-candle-holder-gold-15inchescrystal-beaded-tulip-candle-holder-gold-17inchescrystal-beaded-trumpet-vase-23inch-goldcrystal-beaded-hurricane-vase-gold-37inchescrystal-beaded-candle-holder-goblet-gold-37inchescrystal-beaded-5cup-candelabra-26inch-goldcrystal-beaded-candelabra-gold-13arm-38inchescrystal-beaded-candelabra-gold-5arm-29inch-tallcrystal-beaded-crown-candle-holder-9inchescrystal-beaded-votive-holder-pillar-3inch-goldcrystal-beaded-votive-holder-pillar-4inch-goldcrystal-beaded-votive-holder-pillar-6inch-goldgold-and-real-crystal-cylinder-vase-16inchcrystal-gold-candle-holder-setcrystal-beaded-gold-tulip-candle-holder-setsmall-gold-crystal-beaded-candle-holder-table-topcrystal-beaded-candle-holder-gold-trimgold-crystal-wedding-votive-holders-144274crystal-beaded-candle-holders-goldhuge-crystal-beaded-candle-holder-centerpiececrystal-beaded-candle-holder-gold-10inchesreal-crystals-gold-goblet-candle-holder-9-inchestall-real-crystal-beaded-candle-holder-weddings-15inchesgold-crystals-wedding-candle-holder-setcrystal-beaded-napkin-ring-silver-singlecrystal-beaded-napkin-ringcrystal-beaded-crown-large-goldcrystal-beaded-crown-medium-goldcrystal-beaded-crown-large-silvercrystal-beaded-crown-medium-silverround-crystal-wedding-cake-stand-prestige-10inchround-crystal-wedding-cake-stand-prestige-14inchround-crystal-wedding-cake-stand-prestige-17inchcrystal-pendant-silver-pedestal-cake-stand-17inchcake-stand-crystal-beaded-silver-platedcrystal-beaded-round-pedestal-cake-stand-mirroredcrystal-beaded-square-cake-stand-mirroredcrystal-beaded-eiffel-tower-silver-5feetcrystal-beaded-chandelier-centerpiece-silver-2ftcenterpiecedisplayplazaweddingcenterpiecekitcenterpiecekit39inchdiamondsbagofdiamondscleardiamondledsubmersiblewhiteleddiamondclearlarge-diamonds-silver-wrap-rollsk9-crystal-beaded-garland-strand-small-beadk9-crystal-beaded-garland-strand-large-beadcirclesandsquaresacrylicsquares30foloaofdiacrystalgarlandscircleslaciandocacgroofbe33ya9droofbe33ya9d2roofbe33ya9d1real-crystal-ornament-set-of-2real-crystal-oranaments-large-setdiamondbeadremnants272feet1https://s.yimg.com/aah/shopwildthings/diamonds-beaded-curtains-many-colors-lengths-72.jpghttps://s.yimg.com/aah/shopwildthings/diamonds-beaded-curtains-many-colors-lengths-73.jpg
Our diamond-beaded curtains easily fill up a lot of space and are incredibly versatile — all you need is a little imagination. They can easily form columns or you can create your own chandelier out of them. (Side note: we do sell columns and chandeliers as well, but we don't want to keep the do-it-yourself crowd from having the fun they're entitled to). Would you like your guests to see different colors? All you need to do is shine a different light on them! A colored LED light, that is. And then your gorgeous crystal curtains will easily reflect whatever hue it is you're reflecting off of them.

Our crystal curtains come pre-installed on a hanging rod and are ready to go with just a couple of nails and a hammer. But remember — don't untie them until after they are hung. Just a little tip from us to you to save you a lot of frustration.]]>
irconocobutw rrivreworks yadest
wild-pagewhclde1https://s.yimg.com/aah/shopwildthings/diamonds-beaded-swag-luna-w-ivory-rod-pocket-crystal-iridescent-42-x-20-48.jpghttps://s.yimg.com/aah/shopwildthings/diamonds-beaded-swag-luna-w-ivory-rod-pocket-crystal-iridescent-42-x-20-49.jpgFor the Rod Pocket Color, please choose Ivory or Rose. This valance is 42" wide but the beauty of fabric top curtains is that they can be scrunched to fit small areas or stretched out to cover wider spaces. It's an effortless yet stylish way to totally change up the look of any window, doorway or wall. The strands are sewn into the heavy duty polyester rod pocket and this curtain weighs 1.1 lb. As an accessory for windows, walls and doorways, it's so handy to be able to move the curtain to one side or stretch it out at will. Use a traditional rod, tension rod or add chic sparkle to a Pipe and Drape Ceremony Gazebo Kit by hanging it between the sheer panels. Gorgeous! Scrunch the fabric for a condensed look, stretch it out or hang multiples together to cover wider areas. Use on overhead frames to hang as designer room chandeliers or using a double curtain rod, hang in front of string curtains or our matching Diamonds Beaded Curtains! Crystal Beaded "Luna" Swags - hang in seconds for years of glamour and style!]]>fabric-top-beaded-curtains dibecu becrco becedrwild-pagedibecu1https://s.yimg.com/aah/shopwildthings/diamonds-bulk-large-1-25-bag-of-58-pcs-clear-sasha-30.jpghttps://s.yimg.com/aah/shopwildthings/diamonds-bulk-large-1-25-bag-of-58-pcs-clear-sasha-31.jpgYou'll get 58 pcs of our large Acrylic Diamonds in each bag of "Sasha's". These are a great decoration for your event tables, to fill containers, give as party favors and more! Each diamond is 1.25" wide and .75" tall. Use them to add BLING to your project!dicofortawild-pagerewophonmtv1https://s.yimg.com/aah/shopwildthings/diamonds-crystal-columns-in-pantene-commercials-with-stacy-london-24.jpghttps://s.yimg.com/aah/shopwildthings/diamonds-crystal-columns-in-pantene-commercials-with-stacy-london-25.jpgwild-pagebecrco11https://s.yimg.com/aah/shopwildthings/diamonds-crystal-sparkling-iridescent-column-12-ft-round-premium-quality-beads-82.jpghttps://s.yimg.com/aah/shopwildthings/diamonds-crystal-sparkling-iridescent-column-12-ft-round-premium-quality-beads-83.jpgWe expect this item to come Back in Stock shortly. Often we have a comparable product that we can quickly help you find, so please give us a call at 928.855.6075. If you'd prefer this item only, please enter your email address in the box where it says "Notify me when this item is back in stock!" and as soon as this item is made orderable on our site, you'll get an email from us!

Create glittering, shimmering columns out of thin air with our exclusive new Diamonds Crystal Iridescent Columns.
Or -- turn existing vertical supports into sensational columns of sparkling gems with the very same Diamonds Crystal Iridescent Columns. The ShopWildThings Columns feature PREMIUM QUALITY acrylic beads. It is not a lightweight knock-off. Whether you want to add a column where none exists or cover up a hideous support pole, our Diamonds Crystal Iridescent Columns are the easy answer to a difficult challenge. We designed the columns to hang quickly and easily from the pre-drilled holes in the supporting hoop - To an hide an existing pole, just pull the hoop open and surround the pole with our Diamonds Crystal Iridescent Column. The hanging chains and hardware to close and secure the column are included. It will close around the pole and you can hang as desired. Voila! Problem solved. The Iridescent Coating on top adds a pearlized effect to the high quality faceted acrylic beads. The diameter of the hoop is 18 inches and the length of the column is 12 gorgeous feet! There are 72 individual strands of our Diamonds Crystal acrylic beads (each 12' long) on each column. Wow! That's over 1,000 feet of Diamonds Crystal Iridescent beads on every column. Need more options? You can straighten out the metal hoop and use the resulting 58.5" wide metal band with 72 strands of 12' long beads in many other ways. Need shorter columns? Just puddle the excess length on the floor for a dramatic look or trim with scissors. The total hanging weight is approx 11 pounds. We are proud to offer this product designed right here at www.shopwildthings.com. ]]>
becrco dicrco9fetab dicrbecu12fe chdditw
wild-pagecocoplcrco1faccoinacyadestrrivreworksdecorating-emmy-awards-governors-ballclonviinthli1https://s.yimg.com/aah/shopwildthings/diamonds-round-crystal-column-14-feet-tall-brilliant-dazzling-spectacular-67.jpghttps://s.yimg.com/aah/shopwildthings/diamonds-round-crystal-column-14-feet-tall-brilliant-dazzling-spectacular-68.jpgThe ShopWildThings Columns feature PREMIUM QUALITY acrylic beads. It is not a lightweight knock-off. With sparkling crystal beads flowing down from above, these Diamonds Crystal Iridescent Columns make a huge impact whether your venue is large or small. Instantly create gorgeous, eye-popping ceiling Decor which literally gives a complete make-over to your entire room! We designed the columns to hang quickly and easily by using the hanging chain that's attached to pre-drilled holes in the supporting frame hoop. Simply hang right out of the box! If you'd like to illuminate your column, easy! The top has 6 crossbars with a center hole made for a light kit or downlight with an LED saucer (to the right of the main image, see the 4th photo down). The crossbars are also handy if you'd like to hang additional crystals or flower garlands. The Iridescent Coating on top adds a pearlized effect to the high quality faceted acrylic beads, giving a luminous glow! The diameter of the hoop is 18 inches and the length of the column is 14 gorgeous feet! There are 72 individual strands of our Diamonds Crystal acrylic beads (each 14' long) on each column. Wow! That's over 1,000 feet of Diamonds Crystal Iridescent beads on every column! Need more options? For floor or table Decor, place the column on top of an Adjustable Riser and let the beads puddle on the floor or table. Add a Light Saucer Disc on top to create an illuminated accent piece. If you need a shorter column, you can also trim the strands with scissors and optionally create a scalloped edge. The total hanging weight is approx. 13 pounds. We are proud to offer this product designed right here at www.shopwildthings.com. ]]>dicrco9fetab dicrco20feta dicrbecu12fe dicrbecu18lo clgecu chdditw beloswla cha2halacr 8folomewabec dicu12wi gicsw2ti10fe chcch6lo roofbe33ya9dwild-pagecocoplcrco1faccoinacyadestrrivreworksdecorating-emmy-awards-governors-ballclonviinthli1https://s.yimg.com/aah/shopwildthings/diamonds-round-crystal-column-20-feet-tall-brilliant-dazzling-spectacular-on-30-rock-67.jpghttps://s.yimg.com/aah/shopwildthings/diamonds-round-crystal-column-20-feet-tall-brilliant-dazzling-spectacular-on-30-rock-68.jpgThe ShopWildThings Columns feature PREMIUM QUALITY acrylic beads. It is not a lightweight knock-off. With sparkling crystal beads flowing down from above, these Diamonds Crystal Iridescent Columns make a huge impact whether your venue is large or small. Instantly create gorgeous, eye-popping ceiling decor which literally gives a complete make-over to your entire room! We designed the columns to hang quickly and easily by using the hanging chain that's attached to pre-drilled holes in the supporting frame hoop. Simply hang right out of the box! The Iridescent Coating on top adds a pearlized effect to the high quality faceted acrylic beads, giving a luminous glow! Rather than hanging from the ceiling, if you'd like to use your column with a standing floor riser, our Height Adjustable Free Standing Riser comes with a crossbar for the column to sit on. The diameter of the hoop is 18 inches and the length of the column is 20 gorgeous feet! There are 72 individual strands of our Diamonds Crystal acrylic beads (each 20' long) on each column. Wow! That's over 1,400 feet of Diamonds Crystal Iridescent beads on every column! If you need a shorter column, just puddle the excess strands on the floor for a dramatic look or trim with scissors. You could even create a scalloped bottom by trimming the strands. The total hanging weight is approx. 17 pounds. We are proud to offer this product designed right here at www.shopwildthings.com. ]]>dicrco9fetab dicrcicoco14 dicrbecu12fe dicrbecu18lo clgecu chdditw beloswla cha2halacr 8folomewabec dicu12wi gicsw2ti10fe chcch6lo roofbe33ya9dwild-pagecocoplcrco1faccoinacyadestrrivreworksdecorating-emmy-awards-governors-ballclonviinthli1https://s.yimg.com/aah/shopwildthings/diamond-crystal-columns-for-sale-38.jpghttps://s.yimg.com/aah/shopwildthings/diamond-crystal-columns-for-sale-39.jpgThe ShopWildThings Columns feature PREMIUM QUALITY acrylic beads. It is not a lightweight knock-off. With sparkling crystal beads flowing down from above, these Diamonds Crystal Iridescent Columns make a huge impact whether your venue is large or small. Instantly create gorgeous, eye-popping ceiling Decor which literally gives a complete make-over to your entire room! We designed the columns to hang quickly and easily by using the hanging chain that's attached to pre-drilled holes in the supporting frame hoop. Simply hang right out of the box! If you'd like to illuminate your column, easy! The Iridescent Coating on top adds a pearlized effect to the high quality faceted acrylic beads, giving a luminous glow! The diameter of the hoop is 18 inches and the length of the column is 9 gorgeous feet! There are 72 individual strands of our Diamonds Crystal acrylic beads (each 9' long) on each column. Wow! That's over 600 feet of Diamonds Crystal Iridescent beads on every column! Need more options? For floor or table Decor, place the column on top of an Adjustable Riser and let the beads puddle on the floor or table. Add a Light Saucer Disc on top to create an illuminated accent piece. If you need a shorter column, you can also trim the strands with scissors and optionally create a scalloped edge. The total hanging weight is approx. 9 pounds. We are proud to offer this product designed right here at www.shopwildthings.com. ]]>becrco dicrcicoco14 dicrco20feta dicrbecu12fe dicrbecu18lo clgecu chdditw beloswla cha2halacr 8folomewabec dicu12wi gicsw2ti10fe chcch6lo roofbe33ya9dwild-pagerewophonmtv11https://s.yimg.com/aah/shopwildthings/yanni-design-studio-diamonds-crystal-beads-in-action-26.jpghttps://s.yimg.com/aah/shopwildthings/yanni-design-studio-diamonds-crystal-beads-in-action-27.jpg ]]>beloswla clgecu dicrbecu18lo dicrbecu12fe dicrco9fetab dicrcicoco14 dicrco20feta gicsw2ti10fe 30foloclbest onefowibecu yadechchwild-pageacbecu1https://s.yimg.com/aah/shopwildthings/diamonds-led-ceiling-drape-canopy-pure-white-15-feet-long-57.jpghttps://s.yimg.com/aah/shopwildthings/diamonds-led-ceiling-drape-canopy-pure-white-15-feet-long-58.jpg Two people are needed to install on the ceiling or as a wall backdrop using the four attachment rods with four attach points. Create a canopy or gazebo effect by hanging part of this lighted crystal ceiling drape on the ceiling and letting part dangle to the floor. This ceiling curtain has 30 strands of beads with five strands containing LED lights on thin, silver wire. One end of the crystal acrylic bead drape has a plug-in transformer and 50 inches of electrical cord. We love that LED lights are Earth-friendly and cool to the touch. Use standard C-hooks for installation, or use our magnetic hanging hooks for drop-ceilings.]]>ledceilingdrapeswithbeads diamondceilingdrapes ceiling-drape-iridescent-crystal-beads-warm-led iridescent-crystal-beaded-ceiling-drape cutopborodsw diamondbeadedcurtain6feet diamondbeadedcurtain9feet diamondcrystalcurtain12feetlongwild-pagewhclde11https://s.yimg.com/aah/shopwildthings/diamonds-95.jpghttps://s.yimg.com/aah/shopwildthings/diamonds-96.jpgWedding & Event Canopy Kit and optionally tie back the sides to create an entrance. Our diamond curtains are popular for many reasons and we're not exaggerating when we say how much our customers love these diamond crystal iridescent faceted bead curtains from ShopWildThings. To complete your event theme, pair our Diamonds Promo Curtains with chandeliers or rolls of beads that have the same beautiful iridescent coating.
The gorgeous diamond crystal curtains featured on this page with strands of diamond-faceted iridescent beads have been featured on television shows like CSI: Crime Scene Investigation and Jimmy Kimmel Live. They're a favorite for movie productions, weddings, homes, special events and professional photo shoots, too.
Our video on this page demonstrates how beautifully these crystals capture the light for a shimmering look.
dibecu beculane rollsofbeads
wild-pagerewophonmtv11https://s.yimg.com/aah/shopwildthings/diana-marie-events-avoiding-chaos-on-the-big-day-26.jpghttps://s.yimg.com/aah/shopwildthings/diana-marie-events-avoiding-chaos-on-the-big-day-27.jpgCenterpiece Risers, jelly decor and submersible floralytes working hard at her event, and we’re even more delighted to share some of her tips and tricks with all of you. Diana Marie offers great ideas for making your big day a big success, and one that you and your guests will enjoy from start to finish. All from someone who’s planned some, um, seriously fabulous weddings and events. We learned a lot about today’s trends, about creating a unique and personal event, and about maximizing any budget by talking to her, and we think that you will, too. From her in-the-know trend spotting to her advice for making the most of any budget, we love her enthusiasm and her experience. And we also happen to love photographs like the 2nd one. 1. Tell us a little bit about how you became an event planner. What types of events do you typically plan?
I was always involved and actively planning various events and fundraisers throughout high school and college – all the details and work that goes into planning events is what I adore and enjoy doing. I had helped many of my friends and sorority sisters plan their weddings while at UCF, and when my (actual) sister got engaged, I decided that I would take classes and become certified as a Bridal Consultant. That turned into starting my own business during my last semester of school (then known as A Day to Remember, but changed to Diana Marie Events a few years later to encompass more of the events that we do), and I haven’t looked back! Weddings are the majority of the events that we do throughout Florida and other states (Georgia, Louisiana, California, Washington DC, etc.) and internationally (Italy, Mexico, The Philippines and more), but we also do other social events like our Bridal Showcases, Vow Renewals, Bar & Bat Mitzvahs, Quinceańeras, Reunions, and galas. We even do some corporate events as well. I expanded my business from just planning/coordinating to including design and décor with creating centerpieces, ceremony designs, floral pieces and linens! 2. What is your favorite part of your work?
The details! It’s not just the design and décor details, but also the other intricate details that go into planning each event that makes each one its own unique event! (Speaking of details ~ the centerpiece of florals in the 3rd photo, a variety of vases, and lighting embellished with Crystal Bead Strands and Pendants shows exactly what a pro planner can do with blooms and bling.) 3. What are the top five ingredients for a great wedding reception?
Definitely having an amazing DJ or live band that knows how to be upbeat, fun and an amazing emcee that will keep the party going! Finding ways to get the guests up and dancing and interacting with one another is another ingredient, whether it is with food stations/trucks, dessert bars, photo booths, fun games, and more. Another great ingredient is bringing the vision of the design and décor to life! Bringing the design and decor to life is not just with the centerpieces, linens, drapes, and etc. – it also means bringing the right kind of lighting in to create depth and a better appreciation for everything around. 4. What wedding trends do you love right now? What do you love about them?
I am SO in LOVE with the vintage chic designs right now! I love creating designs that incorporate this trend, while still utilizing the previous trend of crystals and bling. A great deal of our couples and clients are having us design their wedding events to incorporate burlap and/or Lace Linens with the perfect floral arrangements (like baby’s breath with garden roses, peonies, carnations, gerbera daisies or succulents) in mason jars, while accenting the designs with mercury vases/votives and crystal bling! I also love pairing vintage chic with some type of metallic (gold or silver) or glittery color, or some soft colors like mint, butter or soft pink! I also love the pantone color theme of Emerald right now – so hot! I love pairing it with silver or gold! In the 4th photo, we couldn’t resist sharing this photograph that shows exactly what she’s talking about ~ we love the jute/burlap runner, tiered vases, and pretty florals. 5. Any trends that you advise brides to avoid? Why?
Honestly, not really. One of the most important “words of advice” that I always share, remind and stress to my couples is to BE THEMSELVES and THINK OUTSIDE THE BOX. Whether that means making their theme/design revolve around their love for Star Wars or their favorite sports team, or incorporating past trends that some say they are over (such as unity rituals, food trucks, etc.), it doesn’t matter! A wedding is not just a chance for any two people to share their love for one another with their family and friends, but it is a chance to CELEBRATE their love in the way that they want to! There are a lot of crazy details and nuances that my couples choose to incorporate into their wedding because it is what they want because it is who they are, and I don’t mind – it’s fun and it is them! What I do try to steer them away from are favors that get left behind or are an after-thought. 6. What are the “it” colors of 2013-2014 weddings? How are you incorporating them in wedding and reception decor?
2013 is seeing a lot of Emerald incorporated into events, whether it is the main color or used as an accent – emerald looks AMAZING with silver or gold or yellow! Right now mint is also popular, as well as a nectarine or mango color! These colors can be incorporated throughout the wedding and reception décor, whether it is with the flowers, drapes, ceremony chuppah/Mandap/altar, linens, charger plates, dinner plates (love the mismatching vintage plates and cups!), votives, vases, and more! 7. If a bride needs to stretch her decor dollars, what advice would you give her to make the most of a modest budget?
One of the first things I do with my Bride before I even go through budget breakdown is have her list in order of importance the vendors/details that she wants/needs – venue, photographer, décor, cake, catering, etc. From there I do a general budget breakdown with my couple to show them what is the typical percentage breakdown for each vendor/area. Then if we can take away from a few of the least important areas to them to add to the more important areas/vendors, we redo their budget. 8. What signature luxury item would you recommend for a bride with a sky-is-the-limit budget?
Furniture! Luxe linens! And Chandeliers! If the sky is the limit, I would recommend furniture pieces that fit into their scheme, such as “King” and “Queen” individual love seats or love sofa for the couple at their sweetheart table, ghost chairs, acrylic tables, mandaps with richly-colored materials and elaborate floral accents, and more! Incorporating linens that stand out with their textures and colors, such as the satin rosette or sequins. And adding chandeliers or other ceiling pieces like Hanging Crystal Columns would add to the overall beautiful and luxury of an event, especially when the perfect lighting is incorporated to make the chandeliers and other ceiling pieces stand out and sparkle! (We think that she means super luxe events like the one in the last photo ~ you had us at Beaded Curtains and ostrich feathers. The chandelier was just icing on that to-die-for cake in the middle.) 9. What are your favorite Shop Wild Things products? How do you use them, and why do you love them?
I L♥VE L♥VE L♥VE the chandeliers, crystal columns and curtains! These are versatile and add its beauty to the décor. I love that they can be used for practically any theme/color scheme, such as a lavish bling event, outdoor garden party, vintage chic, and more! Your Lighting pieces are also a part of my inventory, and help to create the overall design look for our clients’ centerpieces and more! 10. What is the number one misconception about working with a professional event planner?
It’s not all fun and games for us! It’s not an extension of our own wedding (and I haven’t been married yet!) It’s a stressful, physically and mentally-challenging, detail-oriented job. It’s not a typical 9-5, 40- hours a week job; a “slow” week is at least 40 hours a week, going up to 80+ hours! We aren’t just planning, dealing with details, going to meetings and walk-throughs; we also have to market and promote our business at the same time, while still networking within the industry. We aren’t just a “planner” to the couple – we are also the contact person between all vendors, a designer, a logistics manager, a psychologist, and more! Another misconception is that we aren’t needed. It’s understandable if the Bride/couple wants to take care of all the planning, contacting vendors, and details. But where I stand firm is that everyone should really have at least a Day Of Coordinator. It is not fair to have your family and friends running around to make sure everything is set up for you, communicating with all the vendors the day of, and being behind the scenes rather than being right at the forefront with you. When my sister got married, I hired a PT Day Of Coordinator for her to at least take care of the set-up. I still had my planner/coordinator hat on through the entire day, being on the phone communicating with her vendors while having my hair and makeup done, sending the bridal party in and myself during the processional, and more! I didn’t get to stay around after the ceremony for the pictures because I had to rush over to the reception venue to make sure everything was set up and help the vendors out there. I did manage to eat my dinner, but I didn’t get to enjoy the rest of the reception – I was behind the scenes, and even went to their hotel suite to decorate it for their wedding night. I missed out on the cake, bouquet toss, and EVEN missed my sister and brother in law leaving! Thanks so much to Diana Marie for sharing her time and talent with us. Her excitement about event design is contagious, and we love seeing Diana Marie Events use our products in new and creative ways. We also want to thank the talented photographers whose images feature Diana Marie’s designs ~ Clearly In Focus Photography, Focused on Forever Weddings, Jonas Peterson Photography, and Regina Hyman Photography. We are big believers in hiring established, talented professionals, and we think that the images shown here communicate perfectly the value of working with the best event professionals.]]>
centerpiecekit18inchescrystal k9-crystal-beaded-garland-strand-large-bead crystal-beaded-candle-holder-silver-10inches single-led-submersible-purple glass-candle-holders-set-long-stem-cylinder rose-branch-spray-blush-pink jutetabletopperrectangle crystalbeadedchandelierlarge cream-flowering-dogwood-tree-artificial-6-foot
wild-pagerewophonmtv11https://s.yimg.com/aah/shopwildthings/our-favorite-things-diamond-crystal-columns-style-out-of-thin-air-26.jpghttps://s.yimg.com/aah/shopwildthings/our-favorite-things-diamond-crystal-columns-style-out-of-thin-air-27.jpgDiamond Crystal Columns add glamour to Times Square on New Year’s Eve, we think that they are officially awesome enough for wedding and event venues as well, especially in what we expect will be a year full of themes that emphasize Old School glamour and luxury. The things that we love about these diamond crystal columns: They add a lot of vertical definition even to very large spaces. It is easy to add Lighting to change their color, both during the course of one event and at different events. And they sparkle like crazy, with natural light or event lighting. (The things that we love about Ryan Seacrest: Um, that *smile* will melt butter. Beautiful brown eyes. And he wears a tux for New Year’s Eve. Sold.) In this indoor shot from the New Year’s festivities (2nd photo), you can see how great the columns look in window light, making them an especially good choice for events that span daytime and nighttime hours. They are also a great way to add definition and interest in a large room, or to hide support poles and infrastructure. And one of the most creative uses that we’ve ever seen of the same diamond crystal columns is in the 3rd photo, a lounge chandelier designed by Fouad Farah for Sip Social Lounge in St. Petersburg, Florida. He trimmed the columns to create the asymmetrical bottom edges, and again the lighting finishes off a stunning design while allowing flexibility to change the entire color scheme easily. For daytime and nighttime events and weddings, we think that these columns will fit in perfectly with the luxe themes that we expect to see in weddings and entertainment in 2013. We would love to see how you use diamond crystal columns at your next event. Photos of the indoor set show the main decor pieces being our Diamond Crystal Columns purchased by Walt Disney Company for ABC. ShopWildThings is a preferred vendor for the Disney Companies.]]>becrco dicrco20feta crystal-hanging-column-beaded-strands-large-event-decor beaded-square-columns-sparkling-14ft-hanging ledlightbulbwithremote 6-inch-light-base-color-changing-with-remotewild-pagerewophonmtv11https://s.yimg.com/aah/shopwildthings/diffusion-37.jpghttps://s.yimg.com/aah/shopwildthings/diffusion-38.jpg ]]>gicsw2ti10fe beloswla dicrbecu12fe dicrcicoco14 flfashwh10ya gecucrwild-pagerewophonmtv11https://s.yimg.com/aah/shopwildthings/dinner-for-the-ladies-chandeliers-and-long-curtains-37.jpghttps://s.yimg.com/aah/shopwildthings/dinner-for-the-ladies-chandeliers-and-long-curtains-38.jpg]]>beloswla chhu4timcr72 brbecuclno3x1 suflgrledli1 suflpuuvledlwild-pagedibabecu2https://s.yimg.com/aah/shopwildthings/disco-ball-ornament-4-shiny-silver-50.jpghttps://s.yimg.com/aah/shopwildthings/disco-ball-ornament-4-shiny-silver-51.jpgThere is a minimum order of 2 ornaments.]]>midiba disco-ball-ornament-8incheswild-pagedibabecu1https://s.yimg.com/aah/shopwildthings/disco-ball-ornament-8-shiny-silver-69.jpghttps://s.yimg.com/aah/shopwildthings/disco-ball-ornament-8-shiny-silver-70.jpgDisco Ball Ornament 8" (200mm) Metallic Silver. Disco Ball Ornaments have so many uses these days! Use in centerpieces, in floral designs, as table Decor, and of course as a hanging decoration. This molded heavy plastic disco ball is faceted all the way around and is super reflective and shiny! We also offer real mirror disco balls in a variety of sizes.midiba disco-ball-ornament-4-incheswild-pageaccusobystdibaclirsmbedibaclnecrystal-iridescent-disco-ball-decorative-curtainsilver-disco-balls-decorative-curtaindisco-ball-roll-of-beads2inchdiscoballsetof6disco-ball-ornament-4-inchesdiscoballornament140mmmirrorball4inchdisco-ball-ornament-8inchesmirrorball8inchsilverdisco-mirror-ball-10inchesdiscoballmirroredlarger12inch1https://s.yimg.com/aah/shopwildthings/disco-balls-beaded-curtains-4-options-available-60.jpghttps://s.yimg.com/aah/shopwildthings/disco-balls-beaded-curtains-4-options-available-61.jpgWe've got the biggest collection of disco ball beaded curtains, chandeliers, sparkling disco balls and disco ball ornaments at ShopWildThings. The shiny mirrored beads create fantastic reflections of light and color. We have retro and contemporary designs for your next big event or show-stopping theater stage. Browse our large bead and small bead disco balls curtains in 3-foot widths and 6-foot lengths in silver or pearly iridescent crystal colors. Each curtain is pre-assembled. The 23 strands of beads are each attached to the rod. Click on our how-to video to see how easy it is to hang them with two nails or two hooks. Event planners and disco ball fans love the versatility of our 1-foot wide silver disco ball curtains. Each has 15 strands of super shiny mirrored beads. It's a great buy for tight spaces. Enjoy the contemporary look of white string or black string and disco balls mixed-bead curtains in a 3-foot width and 7.3-foot length. We also have these string/bead curtains in 12-foot lengths.midibawild-pagemidiba11https://s.yimg.com/aah/shopwildthings/disco-balls-small-bead-beaded-curtain-crystal-iridescent-1-ft-x-6-ft-26.jpghttps://s.yimg.com/aah/shopwildthings/disco-balls-small-bead-beaded-curtain-crystal-iridescent-1-ft-x-6-ft-27.jpgdibabecu disco-ball-roll-of-beads acbecuwild-pagemidiba11https://s.yimg.com/aah/shopwildthings/disco-balls-small-bead-beaded-curtain-silver-1-ft-x-6-ft-33.jpghttps://s.yimg.com/aah/shopwildthings/disco-balls-small-bead-beaded-curtain-silver-1-ft-x-6-ft-34.jpgdibabecu mirrorball8inchsilver acbecuwild-pagerewophonmtv11https://s.yimg.com/aah/shopwildthings/disney-dreamers-academy-annual-event-49.jpghttps://s.yimg.com/aah/shopwildthings/disney-dreamers-academy-annual-event-50.jpgWe are so blessed to continue to work with Disney on a yearly basis for this awesome once-in-a-lifetime event for young dreamers! We are trusted to provide Decor in the form of backdrops, tabletop Decor, lighting and more for this spectacular event. Please watch the short video below to learn more about this awesome program. Disney Dreamers Academy program continues its dedicated mission to providing a youth with an opportunity to learn how they can harness the power of their dreams. Through life-enriching interactive workshops and motivational talks, Disney Dreamers Academy gives the Dreamers inspiration to explore the countless possibilities they may never have even imagined and the tools they need to jumpstart turning their dreams into reality. In this powerful four-day program, the Dreamers engage in a wide range of experiences while working hand and hand with community and industry leaders, dedicated Disney Cast Members and some of today's top celebrities. From slicing and dicing with a master chef to bringing illustrations to life with a real Disney animator, our young Dreamers not only learn how to motivate themselves, but also how to inspire their friends, families and communities.wild-pagerewophonmtv11https://s.yimg.com/aah/shopwildthings/disney-entertainment-candle-trees-in-action-26.jpghttps://s.yimg.com/aah/shopwildthings/disney-entertainment-candle-trees-in-action-27.jpg ]]>catrfatrwild-pagerewophonmtv11https://s.yimg.com/aah/shopwildthings/disney-weddings-where-style-meets-magic-57.jpghttps://s.yimg.com/aah/shopwildthings/disney-weddings-where-style-meets-magic-58.jpgFlowering Trees Line a Grand Entrance Fit for a Disney Princess If you’re lucky enough to be able to meld your wedding day with your love of all things Disney princess, Disney Weddings will pull out all.the.stops to be sure that your perfect day is, well, perfect! We are lovers of everything Disney ourselves. And we mean ALL things Disney… Princesses who fall in love with charming princes, strong heroines who do the rescuing themselves, magically clean theme parks, the music, the movies… We grew up on those happy childhood staples, and we’re raising our kids on them. Disneyland is a staple destination for four generations of our family. So when the idea of providing staple pieces to Disney Weddings became a reality, we felt like someone had returned our glass slipper, turned our mermaid tail into human legs, and transformed a beast into a prince all in one day. Disney Weddings takes its brides’ dreams seriously and pulls out all of the stops to create a uniquely magical vision for each wedding day. We are so proud to have a small part in these gorgeous custom weddingscapes as a supplier of key event décor pieces that real, live Disney Weddings designers use to make memories for each of their brides. In the main photo, check out our Flowering Trees lining this lovely outdoor aisle, the rose petal design in the grass, the golden wedding gazebo, and the large chandelier in the ceremony space. We can help you create your own inspired-by-Disney look using these pieces, just as we continue to provide Disney Weddings with the building blocks for custom events like this one. Lighted Tree and Crystal Installation Creates a Dramatic Focal Point Indoors In the 2nd photo, how about this tree turned art installation for a reception focal point? We adore the lighting at the base, the suspended Crystal Bead Strands with geometric candle holders, and the overall effect of modern romance. This vignette is magical, Insta worthy goodness. Floral Half Moon Delights as an Outdoor Ceremony Space When your outdoor wedding ceremony space takes place in a gorgeous location with lots of existing architectural interest, as in the 3rd photo, a Wedding Arch is an elegant means of maximizing the location while focusing attention on the ceremony. We love this Half Moon Circle Arch option, which offers guests a lovely fountain view until the ceremony begins, and frames the nuptials perfectly while the ceremony is in progress. Add live florals, or use our super realistic Faux Florals to embellish the half moon in your wedding colors. And give guests a gorgeous view of the immaculate Disney property while your event takes place. We don’t often see weddings in the round (4th photo), but the half moon works well in this setting as well. Configured to give all guests a view of the ceremony, the circle arch accents the ceremony space without obstructing sight lines. Again, we love real florals if they’re in the budget, and our realistic faux options are an ideal choice if climate, setup constraints, or budget present obstacles to using live florals. And in the last photo, we have to give you one more quick look at our flowering trees lit for nighttime, just to prove how versatile and stunning they are in a variety of settings. We love the effect of the professional event lighting and the Suspended Candle Holders working with this flowering tree at an indoor reception. (For those of you who really know your on trend décor lines, those are our Prestige votives with real crystals suspended from the tree.) We’re having a hard time thinking of anywhere that brides’ dreams meet reality quite the way that they do at Disney weddings. Disney Weddings upholds the values of Disney while working with each bride to create a truly custom experience, and we are thrilled to participate as a supplier of some of Disney designers’ go to décor pieces. We can help you have some of the happiest clients on earth, too. We have the friendliest customer service folks in the event business waiting for your call at 1-928-855-6075. Give us a ring, and let us help you bring magic to your weddings and events, just as we do for some of the most recognizable and loved venues in the world.]]>flowering-trees ropesiropebs wearisma whitechandelier12lights artificial-weeping-willow-tree-green freestanding-metal-wedding-arch-backdrop cabbage-rose-bush-ivory-20inches deluxe-leafy-weeping-willow-branch-spray silk-weeping-cherry-tree-9ft-white crystal-beaded-hanging-candle-holder-gold-7incheswild-pagerewophonmtv11https://s.yimg.com/aah/shopwildthings/frozen-photo-shoot-embree-photography-36.jpghttps://s.yimg.com/aah/shopwildthings/frozen-photo-shoot-embree-photography-37.jpgWhen Embree Photography sent over these amazing images of a recent photo shoot, we darn near fell out of our chairs! She used our "Lafayette" Beaded Curtains and our "Falling Stars" Chandelier to replicate Icicles: "I have had an enormous amount of interest in "Frozen" inspired shoots recently. I bought two beaded crystal curtains from this company and wow! WHAT AN AMAZING PROP!! I overlapped the beads over the rod and it truly looked like an icicle with droplets!" Frozen Inspired Photo Sessions for the Disney Princess in Your House | Princess Elsa as Envisioned by Embree Photography Posted on May 1, 2014 by Beth Beth If you have a little girl who is between the ages of two and eight (ish), you can hardly help but have been introduced to Disney"s box office phenomenon, ŇFrozen," starring spunky Anna and her more popular (if icy) sister Elsa. Judging from our Facebook newsfeeds, Elsa is the runaway favorite character, with Anna trailing behind ~ though our own SPF 50 Family appreciates a redheaded main character more than most. (Note to Disney: best song + best dress = best character. Please produce merchandise accordingly.) In addition to ŇFrozen" Easter baskets, Anna and Elsa party themes, Olaf lookalike snow men (which we could build way too often this winter if you ask us), and Frozen-inspired dress-up events captured on Instagram, we have seen a number of photographic sessions inspired by the movie, which many are calling an instant Disney classic. We had the great fortune to talk to Sarah of Embree Photography recently, and she was kind enough to share her vision and some behind-the-scenes tips about her extremely popular and exceptionally well executed Frozen-inspired photo sessions. We"ve seen good, bad, and ugly Frozen photo sessions, tbh, and nothing we"ve seen comes close to the work that Sarah is doing. When we asked her about her inspiration for these fantastical shoots, we were struck by her response: "The answer is definitely children. Childhood is such a fleeting moment. Kids have so much light and imagination, seeing their faces when they get to be the character they love is the best feeling. My goal is to bring that Ômake-believe" magic to life." Working with a professional stylist, Jennifer Jones of Iced by Jennifer Jones, using Lafayette bead curtains and 30 foot octagon pieces, and sprinkling a little Photoshop fairy dust after the session, Sarah does just that ~ she brings children"s make-believe worlds to life. And the result is a moment in a child"s life, frozen (couldn"t resist) forever in an image that perfectly captures the magic of childhood. We love the way that Sarah uses a chandelier as icicles to recreate the ambiance of Elsa"s frozen ice palace in a regular old pine forest. It"s hard to say it too often: props to the model and to stylist Jennifer Jones, whom Sarah insists deserve much of the credit for images like these. We can"t resist sharing a shot that really shows the over-the-top makeup and styling ~ and the beads ~ up close. This image shows clearly how well the bead curtain creates the ice palace effect. Sarah emphasizes how easy the bead curtains are to work with, and of course they are almost infinitely reusable, as are our chandeliers and bead strands. We"re suckers for closeups of these real, live Disney princesses. You can just tell how much they"re enjoying every moment of being Elsa in her very own frozen ice palace. The attention to detail and craftsmanship is evident in these images, and even the very humble, gracious Sarah doesn"t pretend that this sort of photographic art just happens when you take some bead curtains into the woods: "I spend many hours collaborating, figuring out props, wardrobe, and execution. Then there is significant time spent thinking of different ways to digitally enhance each shot to make the image pop with that dreamy, fairy tale tone. It"s a long process, but so very fun!" For photographers who are inspired by her work, Sarah has these words of advice and encouragement: "Don"t compare yourself to others! The best thing you can do is have confidence in yourself and take the time to learn your craft. Practice, practice, practice and don"t be afraid to ask for help. I have done a lot of my own research, but I have also reached out and met other photographers that I have learned from and in turn, they have become lifelong friends. I cannot begin to express my gratitude for these women, and they know who they are. Photography is a never ending journey, and you are always learning. Never give up!" Proof that creatives are never ready to hang their hats on their last success, Sarah has big ideas about dream shoots that she"d love to photograph. "There are so many themes I"d love to bring to life. I would definitely love to recreate Peter Pan and Captain Hook in Neverland! The setting would be on an island with a jungle and a huge pirate ship!" We can"t wait to see those portraits. All images courtesy of Embree Photography and used with permission.chfst21clnob chfstclnobe lcrclbecuno lcrcl12lonob 19022wild-pageacprso11https://s.yimg.com/aah/shopwildthings/displayers-gold-ornament-hook-set-of-60-pcs-35.jpghttps://s.yimg.com/aah/shopwildthings/displayers-gold-ornament-hook-set-of-60-pcs-36.jpgYou're building a big, beautiful tree. It's no matter if it's a wedding tree, a Christmas tree, or whatever. You're ready to hang your beautiful ornaments and WHAT? All you have are those hideous pack of 20 million for a dollar wire hangers? No, no, sir. You are NOT hanging our pretties on those. All that work? All that money? ShopWildThings to the rescue! Hang your ornaments, pendants and other lovely items from our nice swirly metal displayers. Yes, we know displayer is not a word. Spell check tells us this. But you get the idea. You might also consider using these to make your own creations using our rolls of beads, or our beaded curtains. You can use these to hang strands of beads from a window, from a decorative tree, from a floral arrangement and more. You'll get 60 pcs per order (5 packs of 12). Each piece is 2" long with a 1" diameter swirl at the bottom.disiorhoseto rollsofbeads peacgl gaandst catrfatr glorstofbe gldebahaglglwild-pagesilverdecor11https://s.yimg.com/aah/shopwildthings/displayers-silver-ornament-hook-set-of-60-32.jpghttps://s.yimg.com/aah/shopwildthings/displayers-silver-ornament-hook-set-of-60-33.jpgYou're building a big, beautiful tree. It's no matter if it's a wedding tree, a Christmas tree, or whatever. You're ready to hang your beautiful ornaments and WHAT? All you have are those hideous pack of 20 million for a dollar wire hangers? No, no, sir. You are NOT hanging our pretties on those. All that work? All that money? ShopWildThings to the rescue! Hang your ornaments, pendants and other lovely items from our nice swirly metal displayers. Yes, we know displayer is not a word. Spell check tells us this. But you get the idea. You might also consider using these to make your own creations using our rolls of beads, or our beaded curtains. You can use these to hang strands of beads from a window, from a decorative tree, from a floral arrangement and more. You'll get 60 pcs per order (5 packs of 12). Each piece is 2" long with a 1" diameter swirl at the bottom.digoorhoseto rollsofbeads peacgl gaandst catrfatr glorstofbe gldebahaglglwild-pagerewophonmtv11https://s.yimg.com/aah/shopwildthings/divine-nursery-design-a-little-girl-s-room-with-room-to-grow-14.jpghttps://s.yimg.com/aah/shopwildthings/divine-nursery-design-a-little-girl-s-room-with-room-to-grow-15.jpgPaper Lanterns and poms in pastels and lively colors - the result is a fun mobile and a fabulous decorative element with lots of style at a modest price. And in the 2nd photo, what better way to combine form, function, and fabulous in a corner that will provide your little girl with years of use than to add a pretty Chandelier? Whether you are reading to your little one in a comfy chair or setting a table for afternoon tea, this creative idea will add both light and luxe to your daughter’s room. How about adding a layer of Beaded Curtains between your sheers and the (necessary!) room-darkening curtains — a great way to take advantage of the sparkling light that streams in after naptime without compromising the nap. Our thanks to Cheap Chic Nursery for these great ideas and photographs (used with permission) of a lovely little girl nursery designed by Lesley of Recipe for Crazy. Head over to these talented ladies’ sites for lots more ideas and real room options for stylish, budget-friendly children’s spaces.]]>tissuepaperpompom16inchred tissuepaperpompom20inchlightlime white-eyelet-paper-lantern-8inch pink-glitter-paper-triangle-buntings gypsy-5arm-crystal-beaded-chandelier tupompombase pahalawild-pagerewophonmtv11https://s.yimg.com/aah/shopwildthings/diy-princess-rooms-disney-inspired-style-52.jpghttps://s.yimg.com/aah/shopwildthings/diy-princess-rooms-disney-inspired-style-53.jpgRoom in a Box kits with everything that you need to design gorgeous settings for playing dress up, tea party, castle, and every other make-believe game that requires a canopy and some bling. We've already chosen sets that include a coordinating princess canopy, bead curtain, and chandelier. Just choose the colors that will thrill your little girl most, do the tiniest bit of user-friendly installation (we're talking a handful of hooks), and you have a perfect princess room. Use the canopy over a fluffy bean bag or comfy chair to create a royal reading space ~ and include the chandelier for light, or hang one over the bed. Hang the bead curtain behind sheers for a little peekaboo bling in the sun, or hang it against the wall as a backdrop for dramatic play. Voila ~ a play-friendly, serene sleep supporting princess room ~ with most of the three piece kits priced at $100 or less. This is one of the loveliest little girl rooms we've seen (2nd photo) ~ and you can get a similar look on a much more modest budget by layering bed linens, drapes, and a room-in-a-box kit that includes a chandelier, bead curtain, and of course ~ a princess canopy. For those of you who like to bake a cake mix but make the icing from scratch (we do that, btw), we love looks (3rd photo) that combine a custom detail or two ~ like this estate sale "crown" for the bed ~ with a room-in-a-box kit to get maximum style and maximum savings. Picture 4 is another great example of a custom crown that would work so well with our room-in-a-box kits. This crown would be the perfect place to hide a bead curtain rod, btw, and what princess bed can't use a headboard of bling? A daybed also looks adorable with a canopy ~ we'd put the bead curtain directly behind as a focal point and hang the chandelier inside the canopy. Or maybe we'd use the bead curtains instead of drapes. Or we could hang the bead curtain in the doorway for royal entrances. If money is no object (5th photo), then may we respectfully suggest that one of these custom carriages (it's reportedly $48,000 worth of spherical goodness) is hard to beat for completing that transformation into a castle fit for princess play... But for us, a great value with the key pieces included is a no brainer, and our room in a box kits fit that bill perfectly. As always, we'd love to see how you combine our products with your creativity to thrill the little girl in your life. You can email us images to help@shopwildthings.com anytime ~ please put "Customer Images" in the subject line.]]>roomdecorkitpink heartspink pifch large-pink-foam-flowers-wallscape purplesleepingbeautycanopy chc4swpu ddulabepuirb pinklimebedcanopy budeitbugachwild-pagerewophonmtv11https://s.yimg.com/aah/shopwildthings/diy-trees-perfect-home-accents-and-fall-centerpieces-29.jpghttps://s.yimg.com/aah/shopwildthings/diy-trees-perfect-home-accents-and-fall-centerpieces-30.jpg Manzanita Tree in a Base, and then add burlap birdies and flower clips, hanging tea lights and a pinch off a moss roll. The result is this reusable, customizable tree. Add a small chalkboard sign and you've got a great wedding centerpiece. For your next event, or to complement the change of seasons, simply switch out the accents while keeping the manzanita tree as your base. (Be sure to save the accent pieces from season to season, since you can reuse the ornaments for years.) The manzanita tree itself will also last for lots of years/events, and you can customize it to go with themes, venues, holidays, etc. For fall, we love mixed Metal Bead Curtains as accents against the manzanita trees. Add butterflies, acrylic pendants, bead strands, and even Acrylic Sprays for a layered look that will usher in autumn in style. For Halloween, we can see a blingalicious tree with orange and black acrylic pendants suspended from black bead strands. Burlap wraps hide the wooden base and help make this a quick DIY project, or you can also paint the base. And don't even get us started on how awesome these could be for Christmas. (Check out the Christmas clock to know how much time you've got!)]]>gold4tree haglvoorteho mosspadrectangle bijouorange 19031 34176ey-master-2015stand-alone-flower-wall-backdrop-video-tutorialcutbamboocurtainsaddstrandstocurtainsvihowtoswfaocreate-flower-wall-backdrop-videoflower-wall-backdrop-stand-tutorialviusourpiandshepherds-hooks-video-creative-ideascutwidthbeadedcurtainsshortenbeadedcurtainvideo-crystal-vs-acrylic-beadsococonaauonwestdechusbecuhangbeadedcurtainvideovihowtodebecaddwithtocurtainsviwodobewipachaincurtainhowtovideomagnethooksvispdicrconewlich3dartvidiynosptuthowtousedicovihowtouseceococonaauonweviledlispbabvihowtodefunviledcochdividowhledlirviledcochlirhowtousejedeviledbaeitovvihowtousediviusoaugaddavihowroormoavihowtouseacfiweplviflshflfavigelacselicviledlalidevichlicoki1 Click HERE!]]>wild-pagerewophonmtv11https://s.yimg.com/aah/shopwildthings/does-your-master-closet-have-this-key-design-feature-44.jpghttps://s.yimg.com/aah/shopwildthings/does-your-master-closet-have-this-key-design-feature-45.jpgChandeliers and stunning seating. they're comfortable and chic ~ designed like the rest of the home, to meld form and function, rather than as repositories to be stuffed. There"s got to be a lesson or three in there somewhere!) And frankly, we'd kill for a window seat. Totally different vibe, but we equally love this sleek, bright closet with a built-in work space. The neutral color palette and the bold prints create an upscale look, and the unique light fixture and the silver vases give this area a finished appearance. Again, a totally different approach from our shove-and-slam master closet of a similar size. (For budget-friendly alternatives to liven up your master closet, we love jigsaw lamps, capiz chandeliers and Silver Decor pieces like this owl ~ and this fab urn, and this garden stool.) In the 3rd photo, another unique, envy worthy master closet is this clean, unfussy his-and-hers dressing suite. We adore the glass door cabinets ~ and of course the romantic chandelier adds just the right touch of glam to the space while providing diffuse light that flatters. And one more envy-inspriring closet with amazing lighting in the last photoÉ Pendant lights combine a modern industrial edge with plenty of power to illuminate spaces thoroughly without sacrificing style. This combination dressing island/vanity is a killer design coup, too. Another functional, well designed space with great aesthetic appeal.]]>real-beaded-crystal-chandelier-8lights-34inch puzzlelampwhitemedium capiz-chandelier-real-shells-2feet sicrpagast18 crystalpendantlightmoondance bulbbundlelampwild-pagerewophonmtv11https://s.yimg.com/aah/shopwildthings/does-your-wedding-have-the-three-key-elements-of-a-luxury-event-26.jpghttps://s.yimg.com/aah/shopwildthings/does-your-wedding-have-the-three-key-elements-of-a-luxury-event-27.jpgLED Lighting, as in the 1st photo. We love this example of amazing natural light (coming from a window to the left of the table), accented by two levels of Candelabras, in an already gorgeous venue. (The arc of florals and imaginative use of the space above the table are also great examples of the other two L’s, which kind of proves the point that these three elements together are the calling card of luxurious events.) The 2nd photo illustrates a dramatic example of light from many suspended candles repeated as centerpieces throughout an evening event. This luxurious look is done with hanging votives and Bendable Trees in tall vases, creating a completely different but equally elegant event partly through the skillful use of light. The second critical element that defines a luxury reception is layering as shown in the 3rd photo. Simply put, the most luxurious events stack elegant details vertically to take advantage of the synergy that comes from their sharing space. In this case, a layered whole really is greater than the sum of its parts. This elaborately lit buffet highlights the power of layering, in this case with Chandeliers ~ enhanced by beads and pendants ~ complimenting the tiered centerpieces. (Notice that the lighting is stunning as well.) The large mirrored cake table adds to the layering (with minimal cost) by reflecting the gorgeous display above. Finally, (and we’ll admit to consulting Mr. Thesaurus to keep the alliteration going), every luxury event has a leitmotif ~ a theme that unifies the event and ties it all together. As in the 4th photo, whether you weave Pink Blooms and bling through your big day, as seen in this gorgeous tablescape … Or plan a dream wedding inspired by the venue’s splendid ceiling and conveyed through clouds of Crystal Columns as in the final photo, every luxury event has a common thread that runs subtly through the decor, imbuing it with a sense of elegance and harmony. Whether you’re planning your own million dollar reception, or just want some pro tips to make sure that your slightly simpler affair looks like a million bucks, these three L’s ~ light, layers, and leitmotif ~ are key to making reality match your vision of luxury.]]>crystal-chrome-candelabra-6arm-37inches haglvoorteho goldtreeinbase queenchandelier8lights hydrangea-flower-spray-bouquet-pink cylinder-vase-real-crystal-beaded-16inch-silver 9footcrystalcolumnsquarewild-pagesilk-flower-garlands11https://s.yimg.com/aah/shopwildthings/dogwood-blossom-branch-42-long-bendable-cream-67.jpghttps://s.yimg.com/aah/shopwildthings/dogwood-blossom-branch-42-long-bendable-cream-68.jpgWedding Arch, trellis, banister or railing. Quickly create stylish centerpieces or focal points by placing in 2' Tall Reversible Trumpet Vases. Transform a Pipe & Drape Canopy (with or without the sheers) into a dreamy floral gazebo by wire tying these branches to the poles. This spray is so pleasing and fresh looking that it truly enhances any event, theme or party while allowing a stress-free, lost cost floral solution for you! Please take a moment to view the video featuring this identical spray in white!]]>floral-walls-greenery-backdrops flowering-trees brandsp vaflvaeitocywild-pagesilk-flower-garlands1https://s.yimg.com/aah/shopwildthings/artificial-dogwood-blossom-white-58.jpghttps://s.yimg.com/aah/shopwildthings/artificial-dogwood-blossom-white-59.jpgWedding Arch, trellis, banister or railing. Quickly create stylish centerpieces or focal points by placing in Glass Latour Trumpet Vases. Transform a Pipe & Drape Canopy (with or without the sheers) into a dreamy floral gazebo by wire tying these branches to the poles. This spray is so pleasing and fresh looking that it truly enhances any event, theme or party while allowing a stress-free, lost cost floral solution for you!]]>floral-walls-greenery-backdrops flowering-trees brandsp vaflvaeitocywild-pagesilk-flower-garlands11https://s.yimg.com/aah/shopwildthings/dogwood-blossom-branch-44-tall-bendable-baby-pink-cream-86.jpghttps://s.yimg.com/aah/shopwildthings/dogwood-blossom-branch-44-tall-bendable-baby-pink-cream-87.jpgWedding Arch, trellis, banister or railing. Quickly create stylish centerpieces or focal points by placing in Crystal Beaded Cylinder Vases. Transform a Pipe & Drape Canopy (with or without the sheers) into a dreamy floral gazebo by wire tying these branches to the poles. This spray is so pleasing and fresh looking that it truly enhances any event, theme or party while allowing a stress-free, lost cost floral solution for you!]]>silkflowers vaflvaeitocy ropokiba flowering-treeswild-pagesilk-flower-garlands1https://s.yimg.com/aah/shopwildthings/artificial-dogwood-blossom0-branch-54.jpghttps://s.yimg.com/aah/shopwildthings/artificial-dogwood-blossom0-branch-55.jpgWedding Arch, trellis, banister or railing. Quickly create stylish centerpieces or focal points by placing in Crystal Beaded Cylinder Vases. Transform a Pipe & Drape Canopy (with or without the sheers) into a dreamy floral gazebo by wire tying these branches to the poles. This spray is so pleasing and fresh looking that it truly enhances any event, theme or party while allowing a stress-free, lost cost floral solution for you!]]>silkflowers vaflvaeitocy ropokiba flowering-treeswild-pagedobecu11https://s.yimg.com/aah/shopwildthings/dolphins-beaded-curtain-crystal-iridescent-35-x-6-25.jpghttps://s.yimg.com/aah/shopwildthings/dolphins-beaded-curtain-crystal-iridescent-35-x-6-26.jpgCrystal Iridescent Acrylic Dolphins Beaded Curtain, 35" wide by 6' long Decorative Curtain for Doorways, Windows, Walls or as a Photo Backdrop Fun AND Attractive! This lightweight Dolphin Beaded Curtain is so stunning with white acrylic beads bathed in a pearly iridescent coating! What a perfect addition for a bathroom or a poolside shower room! The iridescent coating picks up the light and sends off soft pastels that look like bubbles! The header rail is white and has 2 eyelets for instant hanging. Use this heavy-duty acrylic beaded curtain in place of regular doors, closet doors, or behind a bed to add the illusion of height to any room! The dolphin pattern on this curtain is very cool and there are 34 strands and you can shorten this curtain without damaging it by simply cutting the strands. This curtain weighs 2.15lbs. Easily add dimension and color with this panel and the fun, party look makes it a great backdrop for photo shoots! dobecu stmobecu acbecuwild-pagedobecu11https://s.yimg.com/aah/shopwildthings/dolphins-beaded-curtain-glow-dark-white-35-x-6-24.jpghttps://s.yimg.com/aah/shopwildthings/dolphins-beaded-curtain-glow-dark-white-35-x-6-25.jpgGlow in the Dark Acrylic Dolphins Beaded Curtain, 35" wide by 6' long Decorative Curtain for Doorways, Windows, Walls or as a Photo Backdrop Fun AND Attractive! This lightweight Dolphin Beaded Curtain is distinctive and fabulous with white beads that are bathed in a light iridescent coating and what's more, this curtain glows in the dark! What a perfect addition for a nighttime pool party! Even in daylight, the iridescent coating picks up the light and sends off soft pastels that look like bubbles! The header rail is a white and has 2 eyelets for instant hanging. Use this heavy-duty acrylic beaded curtain in place of regular doors, closet doors, or behind a bed to add the illusion of height to any room! The dolphin pattern on this curtain is very cool and there are 34 strands and you can shorten this curtain without damaging it by simply cutting the strands. This curtain weighs 2.15lbs. Easily add dimension and color with this panel and the fun, party look makes it a great backdrop for photo shoots! dobecu stmobecu acbecuwild-pagedobecu11https://s.yimg.com/aah/shopwildthings/dolphins-beaded-curtain-iridescent-mardi-gras-3ft-x-6ft-40.jpghttps://s.yimg.com/aah/shopwildthings/dolphins-beaded-curtain-iridescent-mardi-gras-3ft-x-6ft-41.jpgAcrylic Dolphins Beaded Curtain in Mardi Gras Colors, 35" wide by 6' long Decorative Curtain for Doorways, Windows, Walls or as a Photo Backdrop FUN FUN FUN! This lightweight Dolphin Beaded Curtain in the rich colors of Mardi Gras makes a striking addition to any room! The colors blend with shades of purple, blue, green and gold to create a visually interesting pattern. The header rail is black and has 2 eyelets for instant hanging. Use this heavy-duty acrylic beaded curtain in place of regular doors, closet doors, or behind a bed to add the illusion of height to any room! "Mardi Gras" colors are black beads with a coating on top that reflects green, purple, gold and blue. It's very cool! There are 34 strands and you can shorten this curtain without damaging it by simply cutting the strands. This curtain weighs 2.15lbs. Easily add dimension and color with this panel and the fun, party look makes it a great backdrop for photo shoots! dobecu stmobecu acbecuwild-pagedobecu11https://s.yimg.com/aah/shopwildthings/dolphins-beaded-curtain-light-blue-iridescent-35-x-6-24.jpghttps://s.yimg.com/aah/shopwildthings/dolphins-beaded-curtain-light-blue-iridescent-35-x-6-25.jpgLight Blue Iridescent Acrylic Dolphins Beaded Curtain, 35" wide by 6' long Decorative Curtain for Doorways, Windows, Walls or as a Photo Backdrop FUN FUN FUN! This lightweight Dolphin Beaded Curtain in an awesome shade of light blue with an iridescent coating makes a striking addition to any room! The pearly coating sends off different shade of light blue, with a slight touch of purple and hint of green. The header rail is a matching light blue and has 2 eyelets for instant hanging. Use this heavy-duty acrylic beaded curtain in place of regular doors, closet doors, or behind a bed to add the illusion of height to any room! The dolphin pattern on this curtain is very cool and there are 34 strands and you can shorten this curtain without damaging it by simply cutting the strands. This curtain weighs 2.15lbs. Easily add dimension and color with this panel and the fun, party look makes it a great backdrop for photo shoots! dobecu stmobecu acbecuwild-pageaccusobystparty-curtain-acrylic-crystal-beaded-dolphinsdolphins-beaded-curtain-mardi-gras-colorsglow-dark-dolphin-party-curtain-decorationdoglbecuraindollight-blue-dolphins-beaded-curtain-6ft-backdropbluedolphinsdoshbecu1https://s.yimg.com/aah/shopwildthings/dolphins-beaded-curtains-4-colors-available-24.jpghttps://s.yimg.com/aah/shopwildthings/dolphins-beaded-curtains-4-colors-available-25.jpgCelebrate the world's favorite ocean creature with our beautiful dolphin beaded curtains at ShopWildThings. Each curtain is 35 inches wide and 70 inches long. The bead strands are pre-assembled on the curtain rod for easy installation. Click on our how-to video for a quick demonstration on hanging beaded acrylic curtains. Each strand contains small and large round beads interspersed with dolphin-shaped beads. Order yours in rainbow iridescent, blue and white or our fun glow-in-the dark style. The iridescent designs have iridescent coatings on see-through beads. These curtains are terrific choices for doorways, windows and inside or outdoor parties. Install with our optional hooks behind a wall to create a dramatic effect in a bedroom or beach cottage. They're a beautiful way to Decorate a ballroom for the senior prom. Read our five-star reviews from customers who call them awesome. We think they're super awesome, too.curtainhookswild-pagedobecu11https://s.yimg.com/aah/shopwildthings/dolphins-blue-beaded-curtain-41.jpghttps://s.yimg.com/aah/shopwildthings/dolphins-blue-beaded-curtain-42.jpg35" Wide x 70" Long: Our wonderful heavy-duty acrylic beaded curtains are a perfect addition to any room! Use in the place of regular doors, closet doors, or behind a bed to add height to any room! This beautiful curtain has an irridescent finish... This awesome curtain has a pattern as you can see in the photo...it repeats 6 times from top to bottom on the curtain. Try pairing it with one of our blue acrylic lamps which are the exact same blue color!wiwi3bldowild-pageartificialgreenery1https://s.yimg.com/aah/shopwildthings/donkey-tail-trailing-succulent-vine-40-draping-greenery-23.jpghttps://s.yimg.com/aah/shopwildthings/donkey-tail-trailing-succulent-vine-40-draping-greenery-24.jpgMermaid Centerpiece Vase , drape over shorter centerpiece choices like our rustic Whitewashed Wooden Box Planters or even snip the shoots to fit terrariums or wreaths. If your event calls for a backdrop Arch or Gazebo, the draping stems loaded with berries makes this succulent vine the ideal green foliage. If you prefer an overhead floral chandelier, a Wrought Iron Garden Sphere is not only a trendy look but it can be changed up and accessorized for any event or theme. Reliable and attractive plants and greenery for your big event are priceless assets. Save time, simplify your efforts and find what you need from our wide variety of greenery, floral choices and accessories!]]>artificialgreenery effectively-using-spectacular-silk-flowers wearisma vaflvaeitocywild-pagerewophonmtv11https://s.yimg.com/aah/shopwildthings/dorm-room-decor-using-beaded-curtains-and-chandeliers-in-your-dorm-room-37.jpghttps://s.yimg.com/aah/shopwildthings/dorm-room-decor-using-beaded-curtains-and-chandeliers-in-your-dorm-room-38.jpgTo hang pictures, beaded curtains, and chandeliers WITHOUT making holes in the walls, we recommend the 3M Command Line of products. You can Google "3M Command" and go to the Command.com website. There you can find retailers near you as well as download some coupons! They offer MANY damage-free hanging solutions that are perfect for many installations. So try some fun beaded curtains in your dorm room. We know that with the bazillions of colors we offer, you are sure to find a shape, style, and color that you'll just love! Parents, surprise your students with door beads from ShopWildThings! They'll love that amidst all the seriousness of going to school, you've thought of a fun and frivolous thing to let them know you're so proud!]]>acbecu beculane bambeadcur stcuwi18stpewild-pagerewophonmtv11https://s.yimg.com/aah/shopwildthings/dramatic-black-and-white-bead-intensive-wedding-49.jpghttps://s.yimg.com/aah/shopwildthings/dramatic-black-and-white-bead-intensive-wedding-50.jpgMetal Vases, crystal bead strands, candles, and votives bring the sparkle at conversation height. And having your first dance under this wonder of Tamara's design and our sparkle? A bead curtain miracle. Priceless. Finally, the cake table definitely kept up its end of the bargain, combining a gorgeous cake stand with Crystal Beaded Votives and an array of pretty florals. Whatever the space you're transforming, a classic color scheme and some show stopping beaded fabulousness will draw attention exactly where you want it, and away from whatever your venue's flaws might be. We can't resist just one more ~ an artistic shot looking up at a crystal column. It shows the sparkle and little bit of wonder that a stunning piece like this one brings to an event. We love Tamara's use of crystal bead columns to set off the dance floor visually, breaking up the ballroom in a way that is both effective and pretty. (You can see how effective our LED light discs are at adding plug-and-play light to our crystal columns, too. Such a great way to multiply the effect without multiplying the budget.) We would love to chat with you about how to maximize your budget, to draw attention to all the right vignettes within your event, and to add sparkle where you need it, on time and on budget. Give our friendly customer service folks at call at 1-928-855-6075 and let them help turn your creative vision into a value-packed order of high quality Decor supplies that you'll use again and again, at event after event.]]>crystal-hanging-column-beaded-strands-large-event-decor crystal-beaded-square-hanging-column-20ft crystalbeadedchandelierlarge dicrbecu18lo chsetacrirdi vaflvaeitocy cacust ledlidiupvaowild-pagerewophonmtv11https://s.yimg.com/aah/shopwildthings/dressed-to-impress-outdoor-wedding-receptions-36.jpghttps://s.yimg.com/aah/shopwildthings/dressed-to-impress-outdoor-wedding-receptions-37.jpg Outdoor Settings Blend Nature with Installed Elements in the Best of Luxurious Modern Wedding Designs
Enhancing picturesque outdoor settings with luxurious event décor is an art and a balancing act. An experienced professional event designer knows how to take advantage of the natural setting while incorporating a creative vision and the couple’s taste into the overall look and feel of the space. In the main photo,this lovely upscale cabana installation strikes the perfect chord, subtly illuminating the canopy of hardwood trees with Fairy Light Strands, enhancing many of the cabanas with crystal-laden chandeliers, and swathing the entire scene in fabric swags. In the 2nd photo, this rustic chic outdoor wedding reception features bistro light strands above and a long, low centerpiece that blends Florals with candles for a classic look that meshes perfectly with the surrounding forest. The macramé table runner adds an element of texture that we love, too, proving that simple can absolutely be elegant. The overall feel is relaxed, luxurious, and fitting for a modern wedding reception. Finally, this tent structure bedecked in fairy strands is another stunning example of blending the existing outdoor venue with lighting for an overall effect that exudes a wow! factor. Fabric swags on the perimeter soften the tent structure and allow passage between the tent and the surrounding natural areas, while the use of a clear top on the tent takes advantage of the night sky while offering some protection from potential bad weather. As in the final photo, when your location and wedding date offer consistently fabulous weather ~ and palm trees! ~ the fairy strands can stand on their own as a sparkling ceiling for your romantic outdoor reception. We adore the high-low centerpiece concept, with Tall Candelabras punctuating the row of low florals. Whether you’ve booked the outdoor venue of your dreams and need a bit of help adding the touches that personalize and customize it, or you’ve got creative vision in spades and need the top quality décor pieces that will make that vision a reality, we can help. We offer the best of both worlds: the personal attention and great customer service of a small family company, and the global product reach of a larger company. That combination enables us to stock thousands of well made event décor products on site at our brand new warehouse, ready to ship. Take advantage of our best in class customer service and our non-stop product research today by calling 1-928-855-6075, and let us show you why the top names in event design consistently choose us, whether they need large quantities of staple items, a showstopper of a custom piece, or a combination of the two. We look forward to working with you to make your most imaginative event designs come alive at your next booking.]]>
wedding-chuppah-canopy-top-fabric-included wedding-backdrop-sheer-white-curtains k9crystal-chrome-5bulb-chandelier-26inches bistro-patio-light-set-20-bulbs-g40 9ft-macrame-table-runner-natural-accent-piece led-light-curtain-plug-in-warm-white-9ft crystal-chrome-candelabra-6arm-37inches
wild-pageshellcurtains11https://s.yimg.com/aah/shopwildthings/driftwood-garland-72-long-x-4-large-pieces-137.jpghttps://s.yimg.com/aah/shopwildthings/driftwood-garland-72-long-x-4-large-pieces-138.jpg ]]>driftwood-garland-natural-84inches drga72lox3mp driftwood-garland-with-stones wood-stick-glitter-garland-6-feetwild-pagebrowndecor11https://s.yimg.com/aah/shopwildthings/driftwood-garland-72-long-x-3-medium-pieces-113.jpghttps://s.yimg.com/aah/shopwildthings/driftwood-garland-72-long-x-3-medium-pieces-114.jpg

These lovely garlands made up of hundreds of pieces of driftwood shaped by nature are perfect for beach weddings or outdoor entertaining. Create a driftwood wedding arch, and drape driftwood strands over outdoor stands. Bring the rich textures of natural wood indoors to grace tabletops, swag over curtains or wrap a staircase bannister.

One of our customers also ordered our sparkling crystal bead garland to intertwine with the natural driftwood garland for a dramatic look. The traditional gift for a fifth wedding anniversary is wood. Our wood garland can be used to create a driftwood theme for the celebration.

The neutral shade of the natural wood will enhance rustic to contemporary Decor , and it's an elegant way to create a unique look for stage and film production sets. Click on our "How To" page for inspiring photos and videos, as well as smart commercial and private party decorating tips that we hope will inspire your next project. We've been winning rave reviews for our superior qualities and unmatched dedication to customer service for more than two decades.

driftwood-garland-natural-84inches drga72 driftwood-garland-with-stones wood-stick-glitter-garland-6-feet
Perfect Decor for a rustic or beach house, a beach wedding, outdoor entertaining, nautical themed clubs or events and wood is the traditional 5th Anniversary gift! This natural decoration makes a fantastic garland for trimming an evergreen, gracing a mantle or hanging from a soffit, beam or balcony. One of our resourceful customers hung a driftwood garland in a corner to hide a crack in the wall and another creative customer combined it with crystal garlands to create some sparkle and texture! Such clever ideas!

For outdoor entertaining or a beach wedding, use this garland to create aisles or hang it from a wedding arch. Accessorize tables by laying this down the center and add LED candles along with other natural materials like shells and pearls! Other materials that look sensational intertwined with this amazing gift from nature are greenery, ivory tulle and pearl or metallic gold garland strands.]]>
gaandst naafusbupean
Perfect Decor for a rustic or beach house, a beach wedding, outdoor entertaining, nautical themed clubs or events and wood is the traditional 5th Anniversary gift! This natural decoration makes a fantastic garland for trimming an evergreen, gracing a mantle or hanging from a soffit, beam or balcony. One of our resourceful customers hung a driftwood garland in a corner to hide a crack in the wall and another creative customer combined it with crystal garlands to create some sparkle and texture! Such clever ideas!

For outdoor entertaining or a beach wedding, use this garland to create aisles or hang it from a wedding arch. Accessorize tables by laying this down the center and add some shells, pearls and LED candles! Other materials that look sensational intertwined with this amazing gift from nature are greenery, colored tulle, pearl garland strands or colorful blue and green acrylic strands.]]>
gaandst naafusbupean
wild-pageanfilibu1https://s.yimg.com/aah/shopwildthings/edison-filament-bulb-vintage-2-1-2-x-5-1-2-67.jpghttps://s.yimg.com/aah/shopwildthings/edison-filament-bulb-vintage-2-1-2-x-5-1-2-68.jpgThis Vintage Edison Bulb is one stylish bulb you won't want to hide under a lampshade! It's amazing how lights can set a mood and the classy look of this modish antique bulb says trendy, elegance and taste! The clear glass with a slight amber tint will produce a warm glow without being harsh on the eyes. This incandescent bulb has a squirrel cage filament and is perfect for a chandelier or any lamp with a traditional antique feel but we really like the look of exposed bulb applications: use this light in a cord with socket and bundle several together, hanging in staggered lengths. Simple - clean - sophisticated! This decorative bulb is 2 1/2" wide by 5 1/2" long, 40 watts / 120V with a medium base. These bulbs are sold individually.metal-wire-chandeliers anfilibu beculanewild-pageblackdecor1https://s.yimg.com/aah/shopwildthings/eiffel-tower-vase-black-20-set-of-12-54.jpghttps://s.yimg.com/aah/shopwildthings/eiffel-tower-vase-black-20-set-of-12-55.jpgEiffel Tower Vases - Black - 20" - Set of 12 - Search no more for your glass Eiffel Tower Vases! We've got great prices and we'll deliver quickly. These are awesome because they are bottom heavy, making them great for use in your centerpieces. Add some ostrich feathers. Drop some LED lighting inside and you've got an amazing display. Maestro Vases are another name for this style of vase. This is an amazing way to add height to any display. You might consider filling the center of the vase with our Jelly Decor and LED lights. Event centerpieces can be made very easy and fast, and at ShopWildThings we'd love to help you come up with items to help tie your event together with color and beautiful decorations. Eiffel tower vases look beautiful topped with live floral, artificial floral, or feathers! Hang a few strands of our Crystal Garlands from the sides for some extra sparkle. You can also place Eiffel Tower Maestro vases on top of LED Light Discs to light up the entire display, and create battery operated centerpiece lighting that's "all-in-one". We have LED Light Discs that are Warm White, Cool White, and Multi-Color. Our 20" tall vases have openings that vary from 1.25" to 1.5". Slight variations are due to the fact that these are hand manufactured. Note: These items are not suitable for International Shipping. We pack so carefully but damages are sometimes unavoidable during transit. Additionally, if damages on glass items do occur, we reserve the right to replace or refund your transaction based on our shipping cost analysis for your order. Sold in Multiples of 12.ledfliimuuse ledlidiupvao feosfe jedewapeflanwild-pagevaflvaeitocy1https://s.yimg.com/aah/shopwildthings/eiffel-tower-vase-clear-20-set-of-12-54.jpghttps://s.yimg.com/aah/shopwildthings/eiffel-tower-vase-clear-20-set-of-12-55.jpgledfliimuuse ledlidiupvao feosfe jedewapeflanwild-pagevaflvaeitocy1https://s.yimg.com/aah/shopwildthings/eiffel-tower-vase-clear-24-6-pcs-43.jpghttps://s.yimg.com/aah/shopwildthings/eiffel-tower-vase-clear-24-6-pcs-44.jpgWe expect this item to come Back in Stock shortly. Often we have a comparable product that we can quickly help you find, so please give us a call at 928.855.6075. If you'd prefer this item only, please enter your email address in the box where it says "Notify me when this item is back in stock!" and as soon as this item is made orderable on our site, you'll get an email from us!

Search no more for your glass Eiffel Tower Vases! WeÍve got great prices and weÍll deliver quickly. These are awesome because they are bottom heavy, making them great for use in your centerpieces. Add some ostrich feathers. Drop some LED lighting inside and youÍve got an amazing display. Maestro Vases are another name for this style of vase. This is an amazing way to add height to any display. Our 16î tall vases have openings that vary from .75î to 1î Our 20î and 24î tall vases have openings from 1.5î to 2î. Slight variations are due to the fact that these are hand manufactured. They will still look great when used together in groups! Note: These items are not suitable for International Shipping. We pack so carefully but damages are sometimes unavoidable during transit. Additionally, if damages on glass items do occur, we reserve the right to replace or refund your transaction based on our shipping cost analysis for your order. Sold in Quantities of 6.]]>
wild-pagevaflvaeitocy11https://s.yimg.com/aah/shopwildthings/eiffel-tower-vase-white-20-set-of-12-74.jpghttps://s.yimg.com/aah/shopwildthings/eiffel-tower-vase-white-20-set-of-12-75.jpgEiffel Tower Vases - White - 20" - Set of 12 - Search no more for your glass Eiffel Tower Vases! We've got great prices and we'll deliver quickly. These are awesome because they are bottom heavy, making them great for use in your centerpieces. Add some ostrich feathers. Drop some LED lighting inside and you've got an amazing display. Maestro Vases are another name for this style of vase. This is an amazing way to add height to any display. You might consider filling the center of the vase with our Jelly Decor and LED lights. Event centerpieces can be made very easy and fast, and at ShopWildThings we'd love to help you come up with items to help tie your event together with color and beautiful decorations. Eiffel tower vases look beautiful topped with live floral, artificial floral, or feathers! Hang a few strands of our Crystal Garlands from the sides for some extra sparkle. You can also place Eiffel Tower Maestro vases on top of LED Light Discs to light up the entire display, and create battery operated centerpiece lighting that's "all-in-one". We have LED Light Discs that are Warm White, Cool White, and Multi-Color. Our 20" tall vases have openings that vary from 1.25" to 1.5". Slight variations are due to the fact that these are hand manufactured. Note: These items are not suitable for International Shipping. We pack so carefully but damages are sometimes unavoidable during transit. Additionally, if damages on glass items do occur, we reserve the right to replace or refund your transaction based on our shipping cost analysis for your order. Sold in Multiples of 12.ledfliimuuse ledlidiupvao feosfe jedewapeflanwild-pageblackdecor1https://s.yimg.com/aah/shopwildthings/eiffel-tower-vases-black-12-set-of-12-44.jpghttps://s.yimg.com/aah/shopwildthings/eiffel-tower-vases-black-12-set-of-12-45.jpgEiffel Tower Vases - Black - 12" - Set of 12 - Search no more for your glass Eiffel Tower Vases! we've got great prices and we'll deliver quickly. These are awesome because they are bottom heavy, making them great for use in your centerpieces. Add some ostrich feathers. Drop some LED lighting inside and you've got an amazing display. Maestro Vases are another name for this style of vase. This is an amazing way to add height to any display. You might consider filling the center of the vase with our Jelly Decor and LED lights. Event centerpieces can be made very easy and fast, and at ShopWildThings we'd love to help you come up with items to help tie your event together with color and beautiful decorations. Our 12" Eiffel Tower vase holds approximately 7 oz . One order of our jelly Decor fills approximately 27 of these vases. Eiffel tower vases look beautiful topped with live floral, artificial floral, or feathers! Hang a few strands of our Crystal Garlands from the sides for some extra sparkle. You can also place Eiffel Tower Maestro vases on top of LED Light Discs to light up the entire display, and create battery operated centerpiece lighting that's "all-in-one". We have LED Light Discs that are Warm White, Cool White, and Multi-Color. Our 16" tall vases have openings that vary from .75" to 1". Our 20" and 24" tall vases have openings from 1.5" to 2". Slight variations are due to the fact that these are hand manufactured Note: These items are not suitable for International Shipping. We pack so carefully but damages are sometimes unavoidable during transit. Additionally, if damages on glass items do occur, we reserve the right to replace or refund your transaction based on our shipping cost analysis for your order. Sold in Multiples of 12.ledfliimuuse ledlidiupvao feosfe jedewapeflanwild-pageblackdecor1https://s.yimg.com/aah/shopwildthings/eiffel-tower-vases-black-16-set-of-12-92.jpghttps://s.yimg.com/aah/shopwildthings/eiffel-tower-vases-black-16-set-of-12-93.jpgEiffel Tower Vases - Black - 16" - Set of 12 - Search no more for your glass Eiffel Tower Vases! we've got great prices and we'll deliver quickly. These are awesome because they are bottom heavy, making them great for use in your centerpieces. Add some ostrich feathers. Drop some LED lighting inside and you've got an amazing display. Maestro Vases are another name for this style of vase. This is an amazing way to add height to any display. You might consider filling the center of the vase with our Jelly Decor and LED lights. Event centerpieces can be made very easy and fast, and at ShopWildThings we'd love to help you come up with items to help tie your event together with color and beautiful decorations. Our 16" Eiffel Tower vase holds approximately 8 oz, One order of our jelly Decor fills approximately 24 of these vases. Eiffel tower vases look beautiful topped with live floral, artificial floral, or feathers! Hang a few strands of our Crystal Garlands from the sides for some extra sparkle. You can also place Eiffel Tower Maestro vases on top of LED Light Discs to light up the entire display, and create battery operated centerpiece lighting that's "all-in-one". We have LED Light Discs that are Warm White, Cool White, and Multi-Color. Our 16" tall vases have openings that vary from .75" to 1". Our 20" and 24" tall vases have openings from 1.5" to 2". Slight variations are due to the fact that these are hand manufactured Note: These items are not suitable for International Shipping. We pack so carefully but damages are sometimes unavoidable during transit. Additionally, if damages on glass items do occur, we reserve the right to replace or refund your transaction based on our shipping cost analysis for your order. Sold in Multiples of 12.ledfliimuuse ledlidiupvao feosfe jedewapeflanwild-pagewhclde1https://s.yimg.com/aah/shopwildthings/eiffel-tower-vases-clear-12-set-of-12-79.jpghttps://s.yimg.com/aah/shopwildthings/eiffel-tower-vases-clear-12-set-of-12-80.jpgEiffel Tower Vases - Clear - 12" - Set of 12 - Search no more for your glass Eiffel Tower Vases! we've got great prices and we'll deliver quickly. These are awesome because they are bottom heavy, making them great for use in your centerpieces. Add some ostrich feathers. Drop some LED lighting inside and you've got an amazing display. Maestro Vases are another name for this style of vase. This is an amazing way to add height to any display. You might consider filling the center of the vase with our Jelly Decor and LED lights. Event centerpieces can be made very easy and fast, and at ShopWildThings we'd love to help you come up with items to help tie your event together with color and beautiful decorations. Our 12" Eiffel Tower vase holds approximately 7 oz . One order of our jelly Decor fills approximately 27 of these vases. Eiffel tower vases look beautiful topped with live floral, artificial floral, or feathers! Hang a few strands of our Crystal Garlands from the sides for some extra sparkle. You can also place Eiffel Tower Maestro vases on top of LED Light Discs to light up the entire display, and create battery operated centerpiece lighting that's "all-in-one". We have LED Light Discs that are Warm White, Cool White, and Multi-Color. Our 16" tall vases have openings that vary from .75" to 1". Our 20" and 24" tall vases have openings from 1.5" to 2". Slight variations are due to the fact that these are hand manufactured Note: These items are not suitable for International Shipping. We pack so carefully but damages are sometimes unavoidable during transit. Additionally, if damages on glass items do occur, we reserve the right to replace or refund your transaction based on our shipping cost analysis for your order. Sold in Multiples of 12.ledfliimuuse ledlidiupvao feosfe jedewapeflanwild-pagewhclde1https://s.yimg.com/aah/shopwildthings/eiffel-tower-vases-clear-16-set-of-12-72.jpghttps://s.yimg.com/aah/shopwildthings/eiffel-tower-vases-clear-16-set-of-12-73.jpgEiffel Tower Vases - Clear - 16" - Set of 12 - Search no more for your glass Eiffel Tower Vases! we've got great prices and we'll deliver quickly. These are awesome because they are bottom heavy, making them great for use in your centerpieces. Add some ostrich feathers. Drop some LED lighting inside and you've got an amazing display. Maestro Vases are another name for this style of vase. This is an amazing way to add height to any display. You might consider filling the center of the vase with our Jelly Decor and LED lights. Event centerpieces can be made very easy and fast, and at ShopWildThings we'd love to help you come up with items to help tie your event together with color and beautiful decorations. Our 16" Eiffel Tower vase holds approximately 8 oz, One order of our jelly Decor fills approximately 24 of these vases. Eiffel tower vases look beautiful topped with live floral, artificial floral, or feathers! Hang a few strands of our Crystal Garlands from the sides for some extra sparkle. You can also place Eiffel Tower Maestro vases on top of LED Light Discs to light up the entire display, and create battery operated centerpiece lighting that's "all-in-one". We have LED Light Discs that are Warm White, Cool White, and Multi-Color. Our 16" tall vases have openings that vary from .75" to 1". Our 20" and 24" tall vases have openings from 1.5" to 2". Slight variations are due to the fact that these are hand manufactured. Note: These items are not suitable for International Shipping. We pack so carefully but damages are sometimes unavoidable during transit. Additionally, if damages on glass items do occur, we reserve the right to replace or refund your transaction based on our shipping cost analysis for your order. Sold in Multiples of 12.ledfliimuuse ledlidiupvao feosfe jedewapeflanwild-pagewhclde1https://s.yimg.com/aah/shopwildthings/eiffel-tower-vases-white-12-set-of-12-42.jpghttps://s.yimg.com/aah/shopwildthings/eiffel-tower-vases-white-12-set-of-12-43.jpgEiffel Tower Vases - White - 12" - Set of 12 - Search no more for your glass Eiffel Tower Vases! we've got great prices and we'll deliver quickly. These are awesome because they are bottom heavy, making them great for use in your centerpieces. Add some ostrich feathers. Drop some LED lighting inside and you've got an amazing display. Maestro Vases are another name for this style of vase. This is an amazing way to add height to any display. You might consider filling the center of the vase with our Jelly Decor and LED lights. Event centerpieces can be made very easy and fast, and at ShopWildThings we'd love to help you come up with items to help tie your event together with color and beautiful decorations. Our 12" Eiffel Tower vase holds approximately 7 oz . One order of our jelly Decor fills approximately 27 of these vases. Eiffel tower vases look beautiful topped with live floral, artificial floral, or feathers! Hang a few strands of our Crystal Garlands from the sides for some extra sparkle. You can also place Eiffel Tower Maestro vases on top of LED Light Discs to light up the entire display, and create battery operated centerpiece lighting that's "all-in-one". We have LED Light Discs that are Warm White, Cool White, and Multi-Color. Our 16" tall vases have openings that vary from .75" to 1". Our 20" and 24" tall vases have openings from 1.5" to 2". Slight variations are due to the fact that these are hand manufactured Note: These items are not suitable for International Shipping. We pack so carefully but damages are sometimes unavoidable during transit. Additionally, if damages on glass items do occur, we reserve the right to replace or refund your transaction based on our shipping cost analysis for your order. Sold in Multiples of 12.ledfliimuuse ledlidiupvao feosfe jedewapeflanwild-pagewhclde1https://s.yimg.com/aah/shopwildthings/eiffel-tower-vases-white-16-set-of-12-42.jpghttps://s.yimg.com/aah/shopwildthings/eiffel-tower-vases-white-16-set-of-12-43.jpgEiffel Tower Vases - White - 16" - Set of 12 - Search no more for your glass Eiffel Tower Vases! we've got great prices and we'll deliver quickly. These are awesome because they are bottom heavy, making them great for use in your centerpieces. Add some ostrich feathers. Drop some LED lighting inside and you've got an amazing display. Maestro Vases are another name for this style of vase. This is an amazing way to add height to any display. You might consider filling the center of the vase with our Jelly Decor and LED lights. Event centerpieces can be made very easy and fast, and at ShopWildThings we'd love to help you come up with items to help tie your event together with color and beautiful decorations. Our 16" Eiffel Tower vase holds approximately 8 oz, One order of our jelly Decor fills approximately 24 of these vases. Eiffel tower vases look beautiful topped with live floral, artificial floral, or feathers! Hang a few strands of our Crystal Garlands from the sides for some extra sparkle. You can also place Eiffel Tower Maestro vases on top of LED Light Discs to light up the entire display, and create battery operated centerpiece lighting that's "all-in-one". We have LED Light Discs that are Warm White, Cool White, and Multi-Color. Our 16" tall vases have openings that vary from .75" to 1". Our 20" and 24" tall vases have openings from 1.5" to 2". Slight variations are due to the fact that these are hand manufactured Note: These items are not suitable for International Shipping. We pack so carefully but damages are sometimes unavoidable during transit. Additionally, if damages on glass items do occur, we reserve the right to replace or refund your transaction based on our shipping cost analysis for your order. Sold in Multiples of 12.ledfliimuuse ledlidiupvao feosfe jedewapeflanwild-pagebaforledli11https://s.yimg.com/aah/shopwildthings/electrical-extension-kit-25-feet-10-amp-fuse-4-female-plugs-45.jpghttps://s.yimg.com/aah/shopwildthings/electrical-extension-kit-25-feet-10-amp-fuse-4-female-plugs-46.jpgOur multi-purpose extension kit is perfect for those times where you need to make custom power cords for displays. Sometimes you need power outlets where you need it, not where the female or male adapter piece happens to be on your item! This is perfect for holiday displays, connecting additional light strings etc. You will get 1 roll of 20Ft 120v Extension Cord with a 10amp fused male plug. Also includes 4 female SPT2 plugs and instructions. Rated 10amps maximum per cord.wild-pagerewophonmtv11https://s.yimg.com/aah/shopwildthings/element-productions-string-curtains-27.jpghttps://s.yimg.com/aah/shopwildthings/element-productions-string-curtains-28.jpg ]]>frcochyocoanwild-pagerewophonmtv11https://s.yimg.com/aah/shopwildthings/elizondo-wedding-decor-ideas-45.jpghttps://s.yimg.com/aah/shopwildthings/elizondo-wedding-decor-ideas-46.jpg ]]>20050 20059 trinpo4fetan trinpo3fetan 84004 rollsofbeads birchtreeroomdivider birchtree7feet budeitbugach hacaho birdcagescreamnatural fleeurdelisantiquelantern tatopcahowild-pageacbecu11https://s.yimg.com/aah/shopwildthings/emeralds-blue-lime-beaded-curtain-62.jpghttps://s.yimg.com/aah/shopwildthings/emeralds-blue-lime-beaded-curtain-63.jpgWarner Brothers Television's hit show One Tree Hill's set designers are faithful customers of ours! They featured this curtain in a restaurant setting. 35" Wide x 70" Long: Our wonderful heavy-duty acrylic beaded curtains are a perfect addition to any room! Use in the place of regular doors, closet doors, or behind a bed to add height to any room! Iridescent Finish! 23 Funderfully funky strands of lime and blue heaven.wild-pageacbecu11https://s.yimg.com/aah/shopwildthings/emeralds-pink-and-red-beaded-curtain-34.jpghttps://s.yimg.com/aah/shopwildthings/emeralds-pink-and-red-beaded-curtain-35.jpgThe colors in this one are exquisite! 35" Wide x 70" Long: Our wonderful heavy-duty acrylic beaded curtains are a perfect addition to any room! Use in the place of regular doors, closet doors, or behind a bed to add height to any room! Irridescent Finish!wild-pageembecu11https://s.yimg.com/aah/shopwildthings/emeralds-beaded-curtain-purples-iridescent-35-in-x-6-ft-25.jpghttps://s.yimg.com/aah/shopwildthings/emeralds-beaded-curtain-purples-iridescent-35-in-x-6-ft-26.jpgPipe & Drape Backdrop Kits for photo shoots, weddings or trade show and stage backdrops. ]]>embecu purplestuffwild-pageaccusobystnesqclnesqblhuge-purple-emeralds-beaded-curtain-backdropnesqpiroofbe50yacremhalajofkecewadec1https://s.yimg.com/aah/shopwildthings/emeralds-beaded-curtains-4-colors-available-mtv-regis-and-kelly-45.jpghttps://s.yimg.com/aah/shopwildthings/emeralds-beaded-curtains-4-colors-available-mtv-regis-and-kelly-46.jpgcurtainhookswild-pageacbecu11https://s.yimg.com/aah/shopwildthings/emeralds-crystal-beaded-curtain-hit-tv-shows-movies-48.jpghttps://s.yimg.com/aah/shopwildthings/emeralds-crystal-beaded-curtain-hit-tv-shows-movies-49.jpg ]]>emhala roofbe50yacr jofkecewadecwild-pagerewophonmtv11https://s.yimg.com/aah/shopwildthings/emmy-awards-crystal-curtains-sphere-chandeliers-75.jpghttps://s.yimg.com/aah/shopwildthings/emmy-awards-crystal-curtains-sphere-chandeliers-76.jpg Photography by Nadine Froger
Produced by Sequoia Productions
Event: 67th Emmy Awards Governors Ball
Crystal Beads , Swirl Chandeliers, Sphere Chandeliers: ShopWildThings.com We are absolutely THRILLED that once again, ShopWildThings was chosen to provide event Decor for the Primetime Emmy Awards Governors Ball. 4.4 million sparkling iridescent beads from ShopWildThings were used in the Decor, and 21.3 miles of beads were hung throughout the ceiling! Here is an excerpt from the Thank You Note that we got from our friends at Sequoia Productions: "....from the bottom of my heart thank you so much for all your hard work on the Emmys!!!. It was a huge success and we couldn"t be more thrilled with the outcome! We greatly appreciate how much time and energy you spent on making these two nights spectacular. The triumph of this event was due to your support and I really can"t thank you and your team enough...." The items to the right from ShopWildThings were used for this spectacular Decor. Many of the items were customized specifically for this event. Watch the amazing time lapse video shared by Sequoia Productions. ]]>
19011 19009 gicsw2ti10fe dicrbecu9lo dicrbecu12fe
wild-pagerewophonmtv11https://s.yimg.com/aah/shopwildthings/65th-annual-primetime-emmy-awards-36.jpghttps://s.yimg.com/aah/shopwildthings/65th-annual-primetime-emmy-awards-37.jpg --> ]]>frcochyocoanwild-pagerewophonmtv11https://s.yimg.com/aah/shopwildthings/empire-20th-century-fox-tv-show-set-design-23.jpghttps://s.yimg.com/aah/shopwildthings/empire-20th-century-fox-tv-show-set-design-24.jpg]]>19027 gold-metal-chain-curtains largegoldchandelier 14footcrystalcolumnsquare 19026 bigmetallicgoldchandelier8feet chcch6lo red-6-light-crystal-chandelierwild-pagerewophonmtv11https://s.yimg.com/aah/shopwildthings/empire-designs-huge-beautiful-events-26.jpghttps://s.yimg.com/aah/shopwildthings/empire-designs-huge-beautiful-events-27.jpg ]]>wild-pagehome-decorwhiteceramicgardenstoolpurple-garden-stool-sonomablue-garden-stool-tablegreen-garden-stool-edgemereblue-garden-stool-elsawhitegardenstoolwithbuttonsgarden-stool-comogarden-stool-sorrentosilver-geometric-garden-stoolgarden-stool-gold-geometricclearance-ceramic-garden-stool-side-table21395moderngardenstoolburlapstoolssetof2elephantceramicstoolelephanttablegoldsilver-tiki-exotic-ceramic-garden-stool-tablecemegost18x1whitepiercedceramicstoolsilver-garden-stool-accent-tablehyegast18hblgrgastgardenstoolbluebluegardenstoollimegreengardenstoolgastcebl18wsceramic-garden-stool-end-tablegardenstoolpurplehwhgast18hofgast18indoor-outdoor-accent-table-garden-stool6002060021discount-garden-stools-and-tablesacegast17luceramic-garden-stool-silver-tiki-clearancegray-ottomans-setof2sicetcustendblackvelvetstoolleotwistbllotbrlecualskleredst163pc-turquoise-nesting-tables-metal-accent-piecesmetalwildanimalstoolset3pc-zebra-print-nesting-tables1https://s.yimg.com/aah/shopwildthings/furniture-for-home-and-events-78.jpghttps://s.yimg.com/aah/shopwildthings/furniture-for-home-and-events-79.jpg]]>wede exlocu pifllowild-pagerewophonmtv11https://s.yimg.com/aah/shopwildthings/event-branding-with-letters-decor-by-david-stark-design-using-silver-shimmy-curtains-54.jpghttps://s.yimg.com/aah/shopwildthings/event-branding-with-letters-decor-by-david-stark-design-using-silver-shimmy-curtains-55.jpgEasy Customization and Sparkling Value Looking for memorable branding for a corporate event? Wanting to spell out the happy couple"s new monogram with something other than a typical dance floor projection? Our huge selection of bead curtains is endlessly customizable and completely affordable, and bead curtains rock those applications (not to mention so many more). We have thousands of curtains in stock and ready to ship ~ in diamond crystal, iridescent, mirrored, colored, and wood finishes. Best of all, our shimmy and bead curtains check all the boxes: premium quality, durability, sustainability, and endless variety. When the crew from David Stark Design called up with their ideas and plans for this very, very special event, there was a lot of brainstorming here at ShopWildThings. Kathi, the head cheese here, got involved and created the method by which to create these letters using our Shimmy Beaded Curtains. The result, as you can see, is stunning. Add a mirrored shimmy curtain against a dark background, and you have a high contrast focal point that is elegant and effective. And if we can brag for a second, the top shelf quality of our bead curtains makes them ideal for this application, because they are heavy enough to hang solidly, and they are also made of premium materials that allow customization without compromising their structural integrity. For a more subtle effect, a low contrast setup like this light wall with a mirrored shimmy curtain is also extremely striking. We heart the reflections created by this mirrored curtain, and adding simple lighting in the venue will magnify the impact. Wondering whether you can figure out how to modify our bead curtains in real life? Whether you"re an experienced event designer or adding new skills to your repertoire, bead curtain customization is surprisingly easy and highly gratifying. (It"s also kind of fun and weirdly calming.) Removing beads is as simple as disconnecting jump rings to create the negative space needed for letters, shapes, or logos. In short, this effect is absolutely achievable even if it"s your first time, and even more so if you have a well thought out plan like this design super hero does. We love to get work-in-progress photos like this one, partly because we like the behind-the-scenes stuff in general, and also because these shots show the many ways that simple materials like plywood and paper can make a seemingly complicated task totally doable. We couldn"t help but notice how well this mirrored curtain reflects the everyday lighting in this design shop, too. How much more spectacular will it be in the actual event venue, if it is this effective against unfinished plywood and white paper? Helpful Links:

Diamond Beaded Curtains 6' Shimmy Curtains as Used 12' Shimmy Curtains as Used Shimmy is Available in Gold, Too! Looking to stand out as you court your dream client? Have just the right bride to show off a technique that has not been done at every. wedding. this. decade? Customized bead curtains are the answer to lots of questions, including highly individualized branding that looks like a million dollars on a budget of $20-50 per curtain. Bead curtains are one of the foundation pieces that we built ShopWildThings on, and we pride ourselves on continuing to source the best quality curtains and to offer them to you at the best prices. That"s why you"ll see our curtains on TV and movie sets as well as at luxury events around the world. And you can have them in your hands for your next event, too. The nicest customer service folks in the industry are waiting at 1-928-855-6075. We"ll help you choose the right bead curtains and get them shipped wherever you need them to set your business apart from the competition, whatever your budget. Give us a call today, and let"s take your business to the next level.
dibecu slishsimicu metallicsilverbeadedcurtainshimmy12foot
wild-pagerewophonmtv11https://s.yimg.com/aah/shopwildthings/event-design-mojo-to-go-creating-the-perfect-lighted-centerpiece-44.jpghttps://s.yimg.com/aah/shopwildthings/event-design-mojo-to-go-creating-the-perfect-lighted-centerpiece-45.jpgLED Light Discs to create amazing centerpieces. Whether you want a soft white glow, Bright Pops of Color or a rotating array of jewel tones, LED light discs are safest, most cost effective way to achieve the ambience that you're after. These pieces are tough to beat for impact, ease of setup (and break down), and budget friendliness. Simply suspend a chandelier from a centerpiece riser ("boost,") add your choice of LED light disc to the top, and you have an instant centerpiece. We have Predesigned Centerpiece Kits if you prefer, or you can choose your own pieces individually for maximum control and flexibility of design. Add Remote Compatible Lighting to control your display ~ we really do recommend this option if you're lighting chandeliers that are suspended from the ceiling! Whether you're splurging on one piece of Decor for maximum effect or lighting each table with a stunning centerpiece, we think that LED light discs are one of the best ideas out there for combining ambience, color, and visual impact.]]>warm-white-led-saucer led-centerpiece-vase-light-with-remote-4inch-rgb centerpiecedisplayplaza 12-real-wax-candles-in-glass-cups single-led-submersible-purple chandelier3tiercrystalwhitney chri centerpiecekit18inchesclear gicsw2ti10fe 3-inch-vase-light-base-rgb-with-remote-waterproofwild-pagerewophonmtv11https://s.yimg.com/aah/shopwildthings/event-entrances-to-remember-49.jpghttps://s.yimg.com/aah/shopwildthings/event-entrances-to-remember-50.jpgSet the Tone for a Memorable Event with an Elegant Entryway
A professional event designer understands the power of a great first impression, and the event entrance offers an unparalleled chance to make one with each guest. Your event"s entrance is the one space that is guaranteed to be seen by every guest, so it sets the tone for your entire reception. Whether your event theme is over the top fabulousness, understated elegance, rustic chic, or another compelling aesthetic, the event entrance is the perfect place to establish the vibe for your entire affair with a place card table that will have every guest ooh"ing and ah"ing over the overall effect and noticing your attention to them personally. In the main photo, this place card arrangement is a gorgeous example of interactive luxury. Suspending place cards from the strands of a bead curtain encourages guests to consider the entire installation, maximizing the effect of your design and your budget. Whether you are working with a spare-no-expense budget, or strategizing about how best to spend a more modest amount of money, a splurge like this one is a great use of your bride"s budget because it offers wow! impact that sets the tone for a memorable evening. We adore the luxurious topper of live blooms, and if you need to cut costs a bit, consider our super realistic Faux Florals as a great alternative to the exquisite floral display shown here. For an entrance whose elegance lies in its simplicity, consider a gold Manzanita tree with place cards suspended on ribbons. We love the clean design and the fact that the key elements (Manzanita tree, ribbons) are reusable, and we know that guests will enjoy finding their names in this modern entrance piece. Consider adding a few rhinestone and pearl Brooches or Buckles to the ribbons for weight and sparkle. Memorable Outdoor Wedding Receptions Begin with Gorgeous Entryways
If you're lucky enough to be hosting a nighttime wedding reception at an outdoor venue, we have some inspiration for you: this romantic confection composed of greenery, live florals and candles suspended in glass globes. A single Tabletop Candelabra completes the look and ties the entire tablescape together. Suspended candlelight is one of our very favorite Decor elements, and we think that it is incorporated perfectly in this summertime wedding entrance. This rustic chic entrance table (4th photo) sets the tone for an event that is focused on memory making and the people who are most important to the happy couple. We love the mix of natural elements alongside fire and metals, and we think that the feng shui experts among you will agree that harmony resides in this lovely entrance. Reusable geometric candle holders in different heights, including some on stands, are key to the overall effect, and they are a sophisticated element that you'll find yourself reaching for again and again. Whether you are spending until the sun doesn't shine or maximizing a bride"s modest resources, stop-in-your-tracks event entrances are an optimal place to spend thought, energy, and a few extra dollars. Make a name for yourself as one who understands the importance of a good first impression by giving every single guest the star treatment when they arrive, in the form of a personalized invitation to their table conveyed in a show stopping entrance. We would love to help you choose the best Decor products to give your clients the looks that they want at the price points that will set you apart as a true master of value. Because truly, there is always an event budget, and every bride wants to get the most for hers. We make it our business to stock the best quality products so that you can invest once and use them for years, and pass the savings along to your clients. Give our customer service folks a call at 1-928-855-6075, and let us help you find the right mix of Decor products to make the most of your creative vision, your brides" budgets, and your professional reputation.]]>
lcrclbecuno hydrangea-silk-bloom-ivory-33inches rose-bouquet-silk-fuchsia-pink-22inches phala-orchid-white-42-inches tree-in-pot-3-feet-gold-glittered-manzanita hangingcandle getecaho white-metal-cake-dessert-pedestal
wild-pagerewophonmtv11https://s.yimg.com/aah/shopwildthings/event-solutions-shopwildthings-featured-in-june-july-magazine-26.jpghttps://s.yimg.com/aah/shopwildthings/event-solutions-shopwildthings-featured-in-june-july-magazine-27.jpgThe Spotlight and CATIE (Catered Arts Through Innovative Excellence) awards during the Event Solutions and Catersource conferences in March were pulled together with the help of ShopWildThings.com! We are even featured in the June/July 2010 issue of the Event Solutions magazine! From the cover, see how our Glass Balls were used to create this amazing and imaginative chandelier effect on the ceiling. ON the sides, see how our string curtains were added to rectangular frames to create "Fringe Chandeliers"! Ryan Hanson of BeEvents was lots of fun to work with. To quote Ryan: "As an event, everything fit, and it fit really, really well."gldehaba60se gldehaba80se gldehabaseto glrohaorstca stcuwi18stpewild-pagerewophonmtv11https://s.yimg.com/aah/shopwildthings/event-superhero-brian-wasser-of-electric-events-dc-59.jpghttps://s.yimg.com/aah/shopwildthings/event-superhero-brian-wasser-of-electric-events-dc-60.jpg1. Your website is one of the most engaging that we've seen. The energy of your events comes right through the screen. How do you bring the fun, sophisticated feel that you are known for to your events?
We live for experiences. The event industry is all about the experience and energy helps bring that to life. What makes me and my company so unique is how we understand psychology and thinking. I call it the "psychology of the guest." What are they thinking and why? What causes them to do and feel certain things? How do we bring that out of them? I understand how to evoke emotion and encourage people to act or feel a certain way. This lets me structure events in a specific way. Why should something happen at a specific time, or where do we put something for a given impact. I think being genuine and passionate in your approach is important, especially in today's day where people can see through everything and have information access at their fingertips any time they want it.

At every event we have a few what we call "signature wow moments." It can be something simple or elaborate but it's something unexpected you don't see everyday. From an entertainment standpoint, just playing good music is no longer good enough. Don't get me wrong; the energy/MC portion is by far the hardest part of entertainment, which is why so many DJ's and entertainment companies either don't do it or tell clients "you don't want that." People have this vision of the "wedding DJ" because it's hard to do it well and too often the cheesy and obnoxious way, or none at all, is what people experience. What makes us so unique is our talent and ability to elevate the guest experience from an entertainment and decor standpoint. Once our clients see the difference, there's no going back! But educating them all is hard. By thinking outside the box and understanding guest and event psychology, we're able to bring that fun, unexpected, and elevated experience to make all of our events unforgettable and unique. 2. Tell us about a few of your favorite event projects. What do they have in common, and what makes them unique?
One of our largest clients is the University of Maryland. We have become their "go-to" company and me their go-to guy. I love when they come to me with random projects and it's my job to solve them or figure out how to get it done. It means a lot that they trust us. We produced the groundbreaking/unveiling of their brand new athletic facility and came up with some really creative ideas. They wanted a signature moment (duh!) but didn't have the means to actually break ground. I had an idea of setting up a huge video wall as a stage backdrop. We created a video that looked like a concrete wall and brought in huge rubber mallets. The VIPs came on stage with the rubber mallets and at the right time, "smashed" the video wall. The video was set up so at the second of impact, the "wall" crumbled to reveal an artistic rendering of the completed project. It was an outside-the-box way to do something they didn't think they could do and the crowd loved it!

Another favorite project was a recent wedding that wanted to wow her guests. One of the centerpieces was a huge crystal chandelier treatment over the dance floor using a combination of your crystal chandeliers. The hotel, of course, said no rigging points and rigging isn't allowed so I had to Macguyver a way to hang a dozen chandeliers in the exact placement and design I wanted. I created a gerry-rigged loop with various hanging points and clips and found a way to make it work. It looked amazing! This same bride wanted fireworks at her wedding but wasn't allowed. So, I used a combination of video projection mapping and our indoor sparklers to create a digital fireworks show during her First Dance since she couldn't have the real thing! She was ecstatic.

I think these events all have a common theme of basically let me get creative and "figure out" how to do something. I like these events so much better than when a client comes to me with their list of what they want and all their concrete ideas. There are lots of companies that can just "execute." What makes us special is our ability and desire to think outside the box and go above and beyond for our clients. From an entertainment standpoint, I actually had the privilege of MCing a private event that David Tutera was the event planner for. I have done many celebrity events before for musicians, actors, and athletes, but to actually work with a "celebrity event planner" was such a cool experience different than other celebrities because he isn't really a celebrity but he is in our world! He was such an amazingly nice guy too. 3. We loved hearing about your starting your firm with gifts from your own Bar Mitzvah. If you had to tell us about one high point and one low point on the road to building a successful business, what would you say? What were the lessons that you learned from each?
I think we have had a few high points! One of them was, after doing a very high-profile event one year in DC, said high profile event was moved to San Francisco for the following year. The client called and asked if I would come out and do the event in San Francisco and basically said name your price! That area has so many great entertainment and event companies that it was so cool and humbling to have made such an impact on the organizations that they would have rather paid what it took to fly me out there and have me do the event than hire someone locally.

I would say another high point was the first time we eclipsed 7-figures in annual revenue. When I started this company in high school, I never imagined it would go this far! I think the overall low point is just the anxiety that goes into producing events. Our industry is so different from other industries. If a plumber makes a mistake, he can just come back the next day and fix it. If the car you buy breaks down, you can bring it back to the dealership to fix it or return it. With live events, there are no re-dos or do-overs. A bride can't just gather her friends and family the next weekend to try again if something goes wrong at her wedding! That added pressure of delivering on a one-time momentous occasion is unmatched because we are doing events that have an emotional component attached to them.

I'm also a perfectionist and believe details matter, so when you combine all of this, some of the anxiety can be overwhelming! But the reward for executing is well worth it. I learned that we're all human and things happen, but how you take care of and address them is what matters. Be kind to people, get excited for them, and genuinely care about the success of the event and you can do no wrong. 4. Your dream client is walking in the door in 5 minutes. What will he or she say to you that will let you know that your creativity is about to be unleashed? What ideas do you offer to let this client know that you're his or her dream event designer, too?
I am a personality-guy, which probably even comes through in these words! I love people, but more importantly, I love bringing out the best in people. My dream client lets me do that. They are outgoing and excited for their event like I am, have some ideas, but are also totally open to direction and creativity. My style is certainly modern/contemporary/sparkle/flashy whatever you want to call it. That is where I excel, so my dream client would want that style and vision. Don't get me wrong, we have bistro lights, wine barrel bars, and farm tables with the best of them LOL! But the innovative and modern feel is way more what excites me.

I like clients that aren't afraid to step outside the box and be bold. I am so glad we are starting to see that trend fade. No more ivory and blush every weekend, please!! Color isn't going to kill you, I promise ;) I am also very glad that purple is the Pantone color of the year because that's our company color, so a client that wants to incorporate color always makes me happy. I can tell right away if we will hit it off personality-wise. There are a lot of talented designers out there and DJs and photographers, but if you have a personality and style mesh, the event is just going to be that much more successful. 5. Your website shows so many modern, sophisticated event designs. We're kind of delighted to see that our chandeliers, lighting solutions, and event décor play a part in many of your featured events. What are your favorite ShopWildThings event décor pieces, and why do you love them?
I love ShopWildThings! I like my favorite piece is the Mirabella Chandelier. It's beautiful and modern but can also be adjusted to fit different design styles. I like the shape and the size because that also makes it versatile. We own tons of your chandeliers, Crystal Curtains, centerpiece risers, etc. etc. I think your pieces offer a visual elegance and sparkle that is needed to enhance some event spaces. When lit correctly as well, the crystal reflects light and looks amazing in photos. I love to have different pieces that both work together but also independently. It allows for not only creative design, but let's face it, I am a business, so it lets me re-use pieces in various ways to keep my costs down and thus allow my clients' budgets to go further. Lastly, your customer service is great! Everyone I've ever spoken to at ShopWildThings has always been so helpful and accommodating. 6. What advice do you have for aspiring event designers who want to build successful businesses? Are there common pitfalls for up-and-coming designers, and if so, what advice do you have for avoiding those potential mistakes?
I by no means think I am an expert. Let's start there. I LOVE what I do and like to think I know what I'm doing, but what's unique about me is that I have never worked for another company, never been trained by anyone else, I have always just done things I way I thought they should be done. So, take all of my advice with a grain of salt!

My biggest advice is to make sure you get excited about event design and execution, sitting down with a client, and delivering on the experience. If you "dread" being at work on a Saturday night or don't want to meet with clients after-hours because it's too much work, this is not for you! I genuinely get excited to design and produce events, so much so that sleep doesn't always happen because my brain won't shut off. If this feels like work, you are doing it wrong. So first advice is love what you do.

I would also encourage you to start small. You don't need to be doing $100,000 weddings at the Four Seasons right away to be successful. Let it take time. Maybe donate your services to a local non-profit to gain experience, or do some events for friends at a discounted rate. I started this company DJing basement parties for $25/hour. We now do 7-figures in revenue and over 400 events a year. It didn't happen overnight! And that's OK. I think you need to have a passion for this and really love making people happy. I lost my dad sort of unexpectedly 2 years ago on a Thursday. I was booked and contractually obligated for an event that Saturday, 2 days later. My client of course understood if I needed to be with my family, take time for myself, etc. But I did the party. Why? Because doing what I do makes me happy. It was one of the best parties I have ever done. I got a hug from a crying client when the event ended. Unbeknownst to me, she had recently beaten cancer and this party was partially her celebration. I was able to deliver a memory she and her friends/family will never forget and it would not have happened if producing and entertaining at events was just a job and not my passion.

Love what you do and you never work a day in your life. Speaking of which, my dad taught me my favorite quote that I still use all the time in my industry. He attributed it to the Waldorf Astoria in NYC but who knows. "The difficult I can do immediately. For the impossible, give me a few minutes." I live by that and love making magic happen at our events! I hope to instill that can-do attitude into my 2.5 year old son Dylan and 10-month old daughter Eliana. ]]>
becrco swirl-chandeliers chhu4timcr72 dibecu becedr crystal-beaded-hurricane-vase-silver-37inches wedding-backdrop-sheer-white-curtains wedding-drape-backdrop-kit-romantic oaflsulodesy

Our obvious first reaction was "Look at the Beaded Curtains! 💎The lighting design! The layout!" And then we read the caption which epitomizes this fabulous business we are in: lifting each other up, making sure that everyone involved gets proper credit for their part. Spectacular design doesn't just happen, it takes a village! Photo and post below from @victoriadubinevents ・・・ "Everyone has arrived #SOLETS get this party started ! Event design @bobconti_ @plibby10 @edlibbyevents Entertainment @morganh419 @danfish @totalentertainmentnyc Photography @michaeljurick Event Planning @monikapernal and our entire team @victoriadubinevents " #beadedcurtains #eventdesign #lightingdesigners #crystalcurtains #eventproduction #eventdesign

A post shared by ShopWildThings - Event Decor (@shopwildthings_Decor) on

shinylargediamondcurtains12feetlong largediamondscurtains9foot 24footlongcurtaindiamante large-diamonds-iridescent-curtain-12-feet-long exlocu
wild-pageprops-backdropslargediamondscurtains9footlarge-diamonds-iridescent-curtain-12-feet-longshinylargediamondcurtains12feetlongdiamanteduocrystalcurtain20feetlongbetopdibecudiamonds-bendable-top-curtain-crystal-irid-3x12dicrbecu9lodicrbecu12fedicrbecu18lodicrbecu24lodiamond-beaded-curtain-satin-top-9footdiamond-beaded-curtain-satin-top-12footdiamond-beaded-curtain-satin-top-20footsilver9footdiamondscurtainssilver-diamond-curtain-12-feet-longgolddiamondscurtain12feetlonggold-diamond-bead-curtain-12-feetdiamonds-curtain-yellowgold-9feetdiamondbeadedcurtain9feetdiamondcrystalcurtain12feetlongdiamondcrystalbeadedcurtainnoniridescent20footdiamondnon24footbrbecuclno3x1acandeibx12c190941909524footlongcurtaindiamante9footlong-shiny-silver-bubbles-backdropbusibecu12fe20foot-shiny-silver-bubbles-curtain-backdropcustom-ballchain-nickel-curtain11904619016metallic-circles-and-crystals-11-foot-curtainmetallicsilverbeadedcurtainshimmy12footmetallicgoldbeadcurtainshimmy12footlcrcl12lonobbachfamebrsibachfamestcostcuwhexlo14stcuwh20string-curtain-white-20ft12foot-ivory-string-curtain-backdropstring-curtain-silver-12ft12foot-black-string-curtain-backdrop55730011string-curtain-black-20feet12foot-golden-blonde-string-curtaindicrco9fetabdiamonds-iridescent-beaded-column-12feet-longdicrcicoco14dicrco20fetahanging-crystal-beaded-square-column-9ftlong9footcrystalcolumnsquarebeaded-square-columns-sparkling-14ft-hanging14footcrystalcolumnsquarecrystal-beaded-square-hanging-column-20ft20footcrystalcolumnsquare12footlong-hanging-shimmering-gold-column6ft-round-metal-chandelier-frame-2tieroverhead-banner-frame-2tier-hangingdiamondceilingdrapesled-fairy-lights-ceiling-drape-with-beadsledceilingdrapeswithbeadsceiling-drape-iridescent-crystal-beads-warm-lediridescent-crystal-beaded-ceiling-drapeled-organza-curtain-purewhite-12ootled-organza-curtain-warmwhite-12foot8folomewabec8folomewabec1steelballchaincurtains8folomewabec2repvcmesibeclargedarksilvercurtainlargemattesilverchandelier9arm-27inch-crystal-beaded-gypsy-chandelierewhcr8lich29queenchandelier8lightswhitechandelier12lightsfrostsilverchandeliercapiz-chandelier-real-shells-2feet19011chddiduobrsichddiduocrirlargeeventchandeliercrystalbeadedchandelierlargesilverbeadedchandelierlargeextra-large-party-chandelier-crystalextralargesilverchandeliercrystal-diamondcut-spiral-chandeliercrystal-diamondcut-spiral-chandelier-6foot2tier-spiral-chandelier-crystal-beadscrystal-diamondcut-cascade-chandelierb4tiacdichcrystal-diamondcut-swag-chandeliercrystal-iridescent-diamond-4tier-chandelier-6ftcrystal-diamondcut-square-chandelier19093chfstclnobebigmetallicgoldchandelier8feetlong-bubbles-party-chandelier-goldlong-bubbles-party-chandelier-silverlong-bubbles-party-chandelier-iridescentchsetasididuchsetacrirdibeloswlachcch6logicsw2ti10fechhu4timcr72chandelier2metal-chain-chandelier-6-lightsantique-copper-pyramid-pendant-light-adjust-lengthround-led-swivel-tubes-pendant-lightplasticshapehanginglampxxlargewhiteplasticshapehanginglampxxlargeredplasticshapehanginglampxxlargeorangeplasticshapehanginglampxxlargepinkplasticshapehanginglampxxlargelimegreenplasticshapehanginglampxxlargelavendercrystal-beaded-eiffel-tower-silver-5feetxlrg-3d-cinderella-carriage-centerpiece5ft-tall-horse-carriage-standing-backdrop3d-pvc-laser-cut-backdrop-8ft-tall-propxlrg-5pc-freestanding-3d-laser-cut-backdrop5pc-xlrg-event-backdrop-freestanding-arches7ftx13ft-carved-wood-fanfold-wedding-backdrop5ft-4panel-carved-wedding-pillar-columnpaintable-flower-backdrop-laser-cut-3dwhite-metal-wedding-arch-3d-eleganceheart-wedding-arch-white-metal-backdropfreestanding-metal-wedding-arch-backdropflower-arch-freestanding-wedding-backdropmirrored-canopy-wedding-archmirror-wedding-gazebo-mandap-chuppah-4-postclear-transparent-lucite-acrylic-gazebo-mandap-chuppahclear-acrylic-wedding-arch-backdrophuge-white-foam-flower-20inch-wide20inch-wide-giant-foam-flower-ivorycream-flowering-wisteria-tree-heart-archbend-branch-faux-white-flowering-tree-tallfaux-cherry-blossom-tree-white-6ftartificial-cream-cherry-blossom-tree-6ftpink-cherry-tree-event-wedding-artificialartificial-cream-flowering-dogwood-tree-6ftfaux-pink-flowering-dogwood-tree-6ftcream-flowering-dogwood-tree-artificial-6-footlight-pink-event-design-tree-6-feet-flowerscream-dogwood-lifesize-silk-flowering-treewhite-dogwood-tree-flowering-lifesize-artificialextra-large-artificial-tree-green-event-prop11ft-flowering-wisteria-tree-dark-fuchsia-pink7ft-artificial-wisteria-tree-flowering-purplewhite-green-artificial-tree-lifesize-wedding-propartificial-lifesize-artificial-flower-tree-propblush-pink-12-foot-artificial-tree-floweringlarge-pink-and-white-flowering-wedding-tree-archlarge-pink-artificial-flowering-wedding-treeartificial-pink-flowering-tree-archfuchsia-flowering-tree-10ft-wedding-archwhite-green-lifesize-flowering-tree-propsilk-weeping-cherry-tree-9ft-whitesnow-fountain-white-weeping-cherry--treeartificial-weeping-willow-tree-greenpink-dogwood-heart-shaped-tree-12-feet6ft-4panel-laser-cut-white-tree9foot-artificial-potted-treegold-floral-riser-5ft-event-displaymermaid-centerpiece-vase-riser-gold-24inchesfloral-riser-stand-with-bowl-gold-29inchesmermaid-vase-tall-riser-gold-39inchestrumpet-vase-centerpiece-riser-gold-27inchescrystal-beaded-hurricane-vase-gold-37inchescrystal-beaded-candle-holder-goblet-gold-37inchescrystal-beaded-candelabra-gold-13arm-38inchescandelabra-bowl-top-4arm-pillar-gold-34inchesgold-candelabra-crystal-beads-5arm-27inchescrystal-candelabra-5arm-hurricane-globes-31inchescrystal-candelabra-5arm-hurricaneglobes-26inchescrystal-chrome-candelabra-6arm-37inchescrystal-table-candle-chandelier-bowl-2tier-32inchcrystal-table-candle-chandelier-bowl-3tier-31inchcrystal-candelabra-5arm-flower-bowl-cups-3feetcrystal-candle-holder-centerpiece-riser-35inchescrystal-candelabra-5arm-hurricane-globes-40inchescrystal-beaded-hurricane-vase-silver-37inchescrystal-beaded-candelabra-silver-13arm-38inchescrystal-beaded-candelabra-silver-5arm-56inchescandelabra-bowl-top-4arm-pillar-silver-34inchescandelabra-crystal-pendant-5arm-silver-27inchesfloral-riser-stand-with-bowl-silver-29inchestrumpet-vase-centerpiece-riser-silver-27inchesflower-bowl-stand-silver-chromemermaid-centerpiece-vase-riser-silver-39inchesflamingoheaddownrosebushwhite49inchmamotylasiextallwhitecandleholdermtatopcrch35frwhtaca32tafrlabltaca32floralstand5potsmermaid-centerpiece-vase-riser-white-39inchestall-wedding-vase-whitewhite-tall-centerpiece-vaseshanging-metal-sphere-with-candle-20inchgarden-spheres-metal-bands-setgarden-spheres-metal-wire-setwrought-iron-folding-ball-18incheswrought-iron-folding-ball-12incheswrough-iron-folding-ball-24inchescuch36x4tifatopcuwigrovchovevitbecrcofrcochyocoanshepherdshook-freestand-adjustable-whiteshepherdshook-freestand-adjustable-silverbecedrgichcrmawimahanging-crystal-column-stand-9-footbase-for-crystal-columns-14-footrising-stand-for-tall-hanging-columns-20-footwedding-drape-backdrop-kit-romanticpole-cover-9-foot-spandexpole-cover-14-foot-spandexpole-cover-20-foot-spandexwhite-base-cover-18x181https://s.yimg.com/aah/shopwildthings/extra-long-extra-large-decor-items-103.jpghttps://s.yimg.com/aah/shopwildthings/extra-long-extra-large-decor-items-104.jpgDon't see what you need? We can CUSTOMIZE just about any of our Beaded Curtains for you with a Bendable Top Rod! We can even put the beads on fabric, add grommets and more! Just let us know what you're looking for, and we will make it happen with a Custom Order. We fabricate in-house in the USA! Just click here and we'll get on it!
ovch ovevit becrco frcochyocoan becedr gichcrmawima
wild-pagerewophonmtv1mamotylasiex1https://s.yimg.com/aah/shopwildthings/extreme-makeover-home-edition-morrocan-room-28.jpghttps://s.yimg.com/aah/shopwildthings/extreme-makeover-home-edition-morrocan-room-29.jpgThe Prewitt Brewer family got the full Extreme Makeover: Home Edition treatment in Florida. This deserving bunch was so grateful for the new space that Ty Pennington and his team (along with hundreds of volunteers) created for them. ShopWildThings was on hand to donate some goodies including some Morrocan Chandeliers.wild-pageevent-decor1diamond-beaded-curtain-satin-top-6footdiamond-beaded-curtain-satin-top-9footdiamond-beaded-curtain-satin-top-12footdiamond-beaded-curtain-satin-top-20foot16ft-white-tulle-ceiling-drape-2layercrystal-beads-and-flowers-ceiling-drape-backdropcrystal-beaded-curtain-valance-42wide-ritzy-swagcubemerodcucfatopcuwigrled-organza-curtain-warmwhite-12footled-organza-curtain-purewhite-12ootled-organza-curtain-warmwhite-8footled-organza-curtain-purewhite-8footsheer-ivory-curtain-panels-wedding-backdropwedding-backdrop-sheer-white-curtainssheer-pink-pipe-and-drape-curtain-panelssheer-blush-panel-pipe-and-drape-backdropsheer-pipe-and-drape-burgundy-wine-panelsheer-curtain-pipe-and-drape-panel-black-backdroppoly-premier-fabric-drapes-and-backdropsfabric-top-pearl-and-glass-bead-7ft-curtainlarge-beads-ivory-fabric-top-curtain-7ft7ft-chocolate-brown-rod-pocket-beaded-curtainhanging-ceiling-frame-for-party-decorations1https://s.yimg.com/aah/shopwildthings/fabric-top-beaded-curtains-126.jpghttps://s.yimg.com/aah/shopwildthings/fabric-top-beaded-curtains-127.jpgMake sure to click on the Video Button on each item to see the true beauty of the bead. In addition to these in-stock Fabric Top Beaded Curtains, we are able to make them for you as well. Want Metal Lynx Chain or BallChain on a fabric or bendable metal top? No Problem! Want a different acrylic bead (or even real crystals?!) on a flexible metal or fabric top? We do that, too! Want a totally custom Hanging Column or Chandelier? We would LOVE to help. We are ALL about making custom orders in our fabrication studio right here in Arizona! You'll deal with a cheerful team who are thrilled to help and just bursting with creative ideas. Make sure to check out our Idea Photos page to see some of our past work.]]>wild-pageshepherds-hooks-video-creative-ideassequinfabricdiwrroascoanflfadefarirojulametatorutubonytuplwh1https://s.yimg.com/aah/shopwildthings/decorating-fabric-tulle-burlap-mesh-sheeting-47.jpghttps://s.yimg.com/aah/shopwildthings/decorating-fabric-tulle-burlap-mesh-sheeting-48.jpgCreate fabulous party, wedding, event and home Decorations using the ShopWildThings collection of Fabric, Mesh, Ribbon and Tulle! We offer beautiful Sparkle Tulle for creating adorable No-Sew Table Skirts and more! Place some of our LED String lights under them and you'll have created a table to remember in no time flat! Our Tulle Bolts are perfect for larger projects and for covering large spaces. We have Pure White and Off-White for Weddings and more. We also offer many colors to create special party themes on arches as well as ceiling drapery for an inexpensive way to Decorate the air space. Our Decorative Mesh is available in flat colors as well as in Metallics! This material is divine for creating your Mesh Deco Wreaths, and the many sizes of Decorative Mesh Ribbon can be wound into your Christmas and Event trees! Our Jute Fabric Rolls, Lace Ribbons and Burlap Fabric Bolts are wonderful for creating beautiful Rustic and Romantic Projects and Tabletops. In addition to Jute Fabrics, we have Jute and Burlap Table Runners and Table Toppers! Our huge selection of Burlap Mesh Rolls are perfect for creating table tops in any color. Just trim them with scissors to create table toppers, or use them for making any craft project. Our large rolls are very affordable!gaandst peacgl glorstofbe rollsofbeads chorbecoev gldebahaglgl tipapompo moro6paof3 brbuwild-pagerewophonmtv11https://s.yimg.com/aah/shopwildthings/fabulous-fall-table-basics-20.jpghttps://s.yimg.com/aah/shopwildthings/fabulous-fall-table-basics-21.jpgJute Table Runner almost anywhere. it's easy to jazz up by putting a narrower runner on top to add color, and it looks great on its own, too. Jute runners are easy to dress up or down and they're a great base layer for a formal dining room, and it works just as well in a casual breakfast nook. Add Candle Lanterns with tea lights and really you can be done working on your day-to-day centerpiece if you choose. Add pumpkins, gourds, and pinecones for an easy, natural look that transitions easily from Halloween into Thanksgiving, and beyond (we'll get to that in a minute). If you're having a dinner party or setting the table for a Thanksgiving to-do, lower the lights a tad, light those tapers (and you could totally switch the ivory tapers out for dark orange or cranberry to add both color and scent), and bring a little more layered loveliness with some moss, candles and subtle Garland Strands that play on your neutral building blocks. Add burlap napkin rings to complement the runner, tuck a bright fall leaf into each napkin ring, and you're off to the holiday races. Gathering things like pinecones and leaves is also a great way to get your children involved in holiday prep. Perhaps the best part about this set of Fab Fall Table Basics is that they'll work really well to take you through the *next* holiday as well. The stores seem to be in full Christmas mode before Halloween, and most of us seem to stay especially busy at this time of year, so it's a nice to be able to switch out a few details (many of which you can probably find in your neighborhood or even in your yard) and be all set for Christmas, too. To prepare for Saint Nick, we suggest swapping the pumpkins for evergreen branches, holly, and ornaments, "installing" red tapers and votives in your candle holders, and perhaps adding a bit of mistletoe to your napkin rings to keep things interesting. And voila ~ your home is all set for another season, with pieces that are reusable from year to year and interesting from gathering to gathering.]]>ga5felopaof25 wooden-planter-box-brown-12inch mosspadrectangle hangingcandle naafusbupeanwild-page1https://s.yimg.com/aah/shopwildthings/fabulous-faux-trees-9-choices-23.jpghttps://s.yimg.com/aah/shopwildthings/fabulous-faux-trees-9-choices-24.jpgOur ever "growing" selection of trees includes arty metal branched trees with or without crystal garlands, realistic bare branched metal trees with removeable glass candle holders, and our too-good-to-be-true Phoenix palms. Our metal trees are made to customize for each occasion with the simple addition of beaded garlands, silk foliage, or flowering branches. After the event, our trees disassemble for easy transportation and storage. wild-pagerewophonmtv11https://s.yimg.com/aah/shopwildthings/fabulous-fauxcades-using-d-cor-staples-at-upscale-events-43.jpghttps://s.yimg.com/aah/shopwildthings/fabulous-fauxcades-using-d-cor-staples-at-upscale-events-44.jpgCreative Lighting, swirl chandeliers and light kits (no wires/plugs needed), and flameless candles. Crystal ceiling drapes, another of our most popular staple pieces, are key to taking this event space to the next level. They work seamlessly with existing chandeliers and metallic chair covers and table linens to complete the look of this reception. Traditional chandeliers are another design staple that upscale event planning firms use, weekend after weekend, to change the look of their tried and true event venues. A crystal chandelier works with Large Fabric Ceiling Drapes to produce a dramatic event space ~ again transforming a bland but functional hotel ballroom into a truly custom venue. (PS ~ We want that chair.) Wherever you are in your event design career, we can help you build a core of staple products that offer great wow! factor for your clients, dependable revenue for your business, and steady use for years. Whether you're choosing your first group of Decor staples or adding splashy pieces to an existing arsenal of Decor pieces, we will help you put together just the right mix of products for your events. Give our customer service representatives a call at 928-855-6075 and take advantage of their years of experience and product expertise. We'll get your next order placed, on your budget and in your time frame, and shipped to your location fast.]]>gicsw2ti10fe dicrbecu18lo crystal-hanging-column-beaded-strands-large-event-dcor ledceilingdrapeswithbeads k9crystal-chrome-5bulb-chandelier-26inches sequinfabricwild-pageaccusobystfabric-flowers-ivory-leaves-and-beadsleavescurtainbrownleavescurtaingreenbrown-ivory-leaves-curtainburgundy-ivory-leaves-curtainrosesbeadedcurtainsilk-flowers-green-and-red-bamboo-curtainfabric-flowers-green-bead-curtain1https://s.yimg.com/aah/shopwildthings/fabulush-flowers-and-leaves-curtains-93.jpghttps://s.yimg.com/aah/shopwildthings/fabulush-flowers-and-leaves-curtains-94.jpgHanging Flowers are ALL THE RAGE for events and weddings right now. How about hanging these and stringing crystal garlands in between? Suspend our Fabulush Curtains from the ceiling and create custom drapes. Create canopies of "Living" Garlands that won't wilt! If you would like to remove the strands from the header rod, simply cut and tie the ends. Each piece of silk fabric is separated by a real piece of hand-cut, hand-painted sustainable bamboo! If you like the thought of big huge chandeliers made out of these, let us know - Custom Orders are our thing! Our Fabulush Flowers Curtains are spectacular for use in Homes, Parties, and Major Events. They all have pretty silk leaves, and are separated by hand-cut, hand-painted pieces of bamboo. Just pull the curtain out of the box and hang it up! You might consider draping these along a ceiling by attaching the ends of each strand to the ceiling and creating the illusion of a floral canopy! Create walls of greenery in seconds. Cut the strands and use them to create hanging flower masterpieces for your wedding!wild-pagerewophonmtv11https://s.yimg.com/aah/shopwildthings/facility-crystal-columns-in-action-26.jpghttps://s.yimg.com/aah/shopwildthings/facility-crystal-columns-in-action-27.jpg ]]>beloswla clgecu dicrbecu18lo dicrbecu12fe dicrco9fetab dicrcicoco14 dicrco20feta gicsw2ti10fewild-pagesubmersibleled1https://s.yimg.com/aah/shopwildthings/fairy-berries-white-10-pcs-floating-glowing-firefly-effect-84.jpghttps://s.yimg.com/aah/shopwildthings/fairy-berries-white-10-pcs-floating-glowing-firefly-effect-85.jpgClick on the short video below to see these in action!Create a magical atmosphere with this set of 10 Fairy Berries lights. Place Fairy Berries all around your party or event for a Firefly effect. They float in water so you can use them in floral designs, in bowls, in pools, in fountains. Use them in the grass and in other unexpected areas to give a super-fun glow and create a stunning visual for your guests. Each little Fairy Berry is 3/4" in diameter. They have a slow on/off fading feature that look like twinking gentle lights wherever you place them. These will surely be a hit for you. WARNING: Choking and tripping hazard. Small parts, not for children. Keep out of walking paths. CR-1220 Batteries are included, installed and are replaceable. Each fresh set of batteries will last more than 20 hours. Take a look at the short demonstration video below.]]>led-fairy-pearls-warm-white-12pcs led-fairy-berry-pearls-white-12-pcs rainboworb9-5inch rainboworb3-75inch ledupwawavawild-pagerewophonmtv11https://s.yimg.com/aah/shopwildthings/fairy-lights-transition-from-holidays-to-everyday-49.jpghttps://s.yimg.com/aah/shopwildthings/fairy-lights-transition-from-holidays-to-everyday-50.jpgFairy String Lights have become one of the safest, prettiest types of lights that you can use to Decorate year round. And not only do they stay cooler than traditional bulbs, but the array of available colors is constantly improving as well. This simple Christmas display is a perfect use of string lights. This tree is inexpensive and a total space saver ~ great for an accent, an area to display Christmas cards, or a micro apartment friendly Christmas tree that saves space without skimping on style. To get a striking room divider like this one, strip a folding screen down to the frame, add branches and fairy lights, and use the lighted screen as an accent or focal point in any room. This light curtain accent wall is a perfect backdrop for a console table. Really, this look would work almost anywhere that you need a high impact, space saving focal point. Fairy lights are a natural fit to make bedrooms chic on a budget. We love this idea for a dorm or teen bedroom. Use tiny clothespins to switch out the photographs and keep the display current. Instant access wall and conversation piece, on a budget. For a touch of romance, LED light curtains are tough to beat. Add mosquito netting or a canopy for a sexy boudoir. This look is hot enough for Valentine's Day and stylish enough for everyday. If you want a striking light display that is totally flexible (right down to plug in and battery operated options) and will never get hot, LEDs are your all purpose solution. We stock great quality products that are ready to ship to make your next event a jaw dropper, or to turn your home into a showplace. Give our friendly customer service representatives a call at 928 855-6075 if you need help choosing the right shipping options to get your products delivered on time, or if you want a little help selecting just the right products for your needs.]]>acledevliflu brandsp led-organza-curtain-warmwhite-8foot wedding-backdrop-sheer-white-curtains bedcawhluwild-pagesilverdecor1https://s.yimg.com/aah/shopwildthings/fairy-string-eiffel-vase-lights-20-warm-white-leds-waterproof-7-74.jpghttps://s.yimg.com/aah/shopwildthings/fairy-string-eiffel-vase-lights-20-warm-white-leds-waterproof-7-75.jpg
Each 7' strand has 20 warm white LED lights spaced 4" apart and they are so intense they even shine through our black Eiffel Vases! Illuminate bouquets, floral arrangements and tulle, wrap around trees, wedding arches, ice sculptures and they're ideal for adding class and elegance to any centerpiece! Since you can bend or fold the wire, these strands are also ideal for projects, displays, areas or costumes where you need a compact strand.

The battery unit measures 2" long by 1" wide and it's only 1/4" high - very flat and easy to conceal. It has an on/off toggle switch and comes with 2 CR2032 replaceable batteries. Before using, open the pack and remove the plastic strip so the batteries can engage. The strand is waterproof but since the batteries are replaceable, the pack is not sealed and needs to be kept dry. So as awesome as this looks immersed in jelly Decor, take care to keep battery unit dry!]]>
ledfliimuuse vaflvaeitocy
wild-pagesubmersibleled1https://s.yimg.com/aah/shopwildthings/fairy-string-lights-20-led-s-copper-string-6-colorful-rainbow-battery-operated-66.jpghttps://s.yimg.com/aah/shopwildthings/fairy-string-lights-20-led-s-copper-string-6-colorful-rainbow-battery-operated-67.jpgRainbow Fairy Lights!! If you don't have electrical access and need a light strand that puts out a lot of light check out this new battery operated LED Bendable Colorful Rainbow RGB Fairy Light Strand! The lights automatically switch twinkling patterns from fast to slow to a fade in an out. This strand has 20 Multi Colored LED lights and the wire is so thin that it's virtually unnoticeable! The wire is only 1/16" wide and is totally flexible. This strand can fit into the smallest of nooks, crannies, spots and gaps. It doesn't get any easier! Unroll the strand, place where you need it, shape it if you need to, insert batteries and you've got your light feature done in no time flat! No fuss = no stress. The wire can be straightened out, doubled up or molded to the shape or space you need. Light up trees and floral arrangements, vases, tables and display cases. Another great thing is that LED's are cool to the touch and you don't have to worry about what surface these lights are against. This light strand is 6' long with an additional 1.5' of wire and battery case with an on/off switch. This strand operates on 3 AA batteries (not included).stline acledevlifluwild-pagetacecenterpiecedisplayplazagold-crystal-centerpiece-risergold-floral-riser-with-crystalscrystal-beaded-pedestal-gold-27inchescrystal-beaded-pedestal-silver-27inchescrystal-pendant-silver-pedestal-cake-stand-17inchcrystal-pendant-dessert-stand-riser-17inch-goldcrystal-tabletop-chandelier-cake-riser-centerpiececrystal-beaded-dessert-table-centerpiece-riserdraping-crystal-beads-centerpiece-riser-cake-standcrystal-beaded-centerpiece-riser-dessert-standfloral-centerpiece-riser-crystal-cake-standtall-crystal-dessert-stand-centerpiece-risercrystal-beaded-round-pedestal-cake-stand-mirroredcake-stand-crystal-beaded-silver-platedgold-crystals-cake-stand10inch-square-mirror-riser-rhinestone-edgecrystal-beaded-square-cake-stand-mirroredmirror-centerpiece-riser-10inch-roundround-crystal-wedding-cake-stand-prestige-10inchround-crystal-wedding-cake-stand-prestige-14inchround-crystal-wedding-cake-stand-prestige-17inchmetal-treat-stand-3tier-antique-silver-20-inchesclear-glass-bead-cake-plate-pedestalclear-glass-treat-pedestal-round-10inchesclear-glass-treat-pedestal-round-12incheswhite-metal-cupcake-standwhite-metal-dessert-display-traywhite-metal-cake-dessert-pedestalwhite-metal-two-layer-dessert-standwhite-eyelet-rectangular-dessert-stands-2pcsfiligree-ring-frames-centerpiece-display-setlargedessertowerrotating-ferris-wheel-dessert-treat-standtall-silver-crown-centerpiece-riser-decorationgold-crown-decorative-riser-2ft-centerpiecegold-metal-crown-centerpiececrown-centerpieces-2pcs-gold-metalgold-crown-metal-decoration-8inchcrown-centerpiece-or-cake-topper-indian-goldwooden-cinderella-carriage-propxlrg-3d-cinderella-carriage-centerpiecerhinestone-silver-cake-topper-fifteenmis-15-anos-rhinestone-quince-cake-toppermr-and-mrs-rhinestone-3x5-wedding-cake-topperrhinestone-silver-our-wedding-cake-topperdessert-stand-set-acrylic-8inches-elevationseriesdessert-stand-set-acrylic-10inches-elevationseriesdessert-stand-set-acrylic-14inches-elevationseriesdessert-stand-set-acrylic-22inches-elevationseriesdessert-stand-set-acrylic-5tiers-28inches-elevationseriescupcake-stand-with-led-lightscenterpiece-riser-kit-39inches-acrylic-elevationseriescenterpiece-riser-kit-26inches-acrylic-elevationseriescenterpiece-riser-kit-20inches-acrylic-elevationseriescenterpiece-riser-kit-14inches-acrylic-elevationseries1100011001110021100311004cardboardcakestandzebrablackandwhitecardboardcakestandzebralightblueandwhitecardboardcakestandzebralightpinkandwhiteoaflsulodesychargerplatesdiwrroascoandicofortasubmersibleledunseacuho1https://s.yimg.com/aah/shopwildthings/cake-cupcake-stands-66.jpghttps://s.yimg.com/aah/shopwildthings/cake-cupcake-stands-67.jpgBrowse our collection of premium cake and cupcake stands for formal weddings or contemporary celebrations. We carry gorgeous beaded cake stands and elegant antique silver and crystal cupcake stands at ShopWildThings. Our terrific in-house staff can help you create custom stands, too. We thrive on helping our amazing event planners and individual customers find the exact look they want for any occasion.

We carry cake stands adorned with crystal beads and handsome centerpiece risers. We have antiqued gold and white combination cake and cupcake stands. Impress the guest list with antique silver and crystal three-tier display stands. Browse our contemporary cupcake towers and classic stands edged with crystals and roses.

A favorite for exceptional weddings is our tree stand in silvery aluminum that will create a stunning centerpiece even after the desserts it holds are gone. Go for the bold with our zebra cardboard cake stands in black and white. Create a birthday party sensation with an Under the Sea cupcake holder decorated with colorful dolphins, whales and sea turtles. We also have a great collection of tubes and plates to help you create your own design.

wild-pagewimeceit1https://s.yimg.com/aah/shopwildthings/fancy-crown-stand-decoration-gold-6-5-x-7-5-35.jpghttps://s.yimg.com/aah/shopwildthings/fancy-crown-stand-decoration-gold-6-5-x-7-5-36.jpgTulle, matching your event colors, between the ribs and place an LED submersible light underneath or simply place the crown on a centerpiece mirror, surrounded by flameless LED candles. This crown makes quite a regal cake topper by itself or fill with colorful Flower Garlands or attach a ribbon to the spire and decorate the ribs (3/16" wide) with acrylic rhinestone stickers. Since these are so lightweight, you can also suspend the crowns from the ceiling with Sparkling Crystal Garland Strands attached at varying lengths! Just let your creative gene take over! From a royal wedding to a princely prom, you'll be proud to show off your imperial taste in design with this Matte Gold Crown!]]>wimeceit prom-homecoming-dance-decorations tacewild-pagebeculane1https://s.yimg.com/aah/shopwildthings/fancy-crystal-beaded-adoria-chandelier-23-73.jpghttps://s.yimg.com/aah/shopwildthings/fancy-crystal-beaded-adoria-chandelier-23-74.jpgThis yummy chandelier is just BEGGING for a spot in your Decor scheme. It's swirly, whirly, and decked out in high shine and sparkle faceted acrylic crystal clear beads. We can see this in powder rooms, dressing rooms, bathrooms, bedrooms...just about anywhere that you'd like a romantic show-stopper chandelier THAT DOESN'T BREAK THE BANK! Overall Height: 23" (from top of frame to bottom bead) Metal Body Height: 15" Diameter of Body: 10.5" Cord/Chain Length From top of Body to Ceiling Cap: 27" Total overall Length: 45.5"(from ceiling to bottom bead) This chandelier is a hard-wire lamp which means that it must be installed into your box in the ceiling. If you need it to plug in, an electrician (or qualified hand-woman!) can do this for you. The ceiling cap is just shy of 4" in diameter. U.L. Listed, use a 25 Watt Type B bulb (NOT INCLUDED) White metal frame, chain, and ceiling cap. White electrical cord. Clear Crystal beads with silver wire attaching them to lamp.wild-pagecatrfatr11https://s.yimg.com/aah/shopwildthings/fantasyland-tree-40-tall-silver-with-acrylic-beads-70.jpghttps://s.yimg.com/aah/shopwildthings/fantasyland-tree-40-tall-silver-with-acrylic-beads-71.jpg(Garland not included - this photo is a representation of the tree using our 4' Long Crystal Beaded Garland Item Item #: 91308902. Your tree will come as the main photo). Your tree will come "in the buff" and ready for you to add decor. Bend the branches (gently) to your desired position. 12 of the main branches have lovely 2" assorted shaped long acrylic crystal pendants already strung to the end! There are also extra bent circles on the end of some of the "branches" so that you can very easily have a place to add your own decor without figuring out how to make it "stay" in place. The branch span is 31" wide, and the height is over 3 Feet tall, at about 40"! The nice and steady base is 16" in diameter and consists of 4 more "branches". This tree is very well made and you'll be proud to showcase it in your home or party.]]>catrfatr gaandst1https://s.yimg.com/aah/shopwildthings/faq-s-and-how-to-s-14.jpghttps://s.yimg.com/aah/shopwildthings/faq-s-and-how-to-s-15.jpgwild-pageshellcurtains11https://s.yimg.com/aah/shopwildthings/faux-capiz-shell-beaded-curtain-movie-dreamgirls-72.jpghttps://s.yimg.com/aah/shopwildthings/faux-capiz-shell-beaded-curtain-movie-dreamgirls-73.jpg ]]>facachne chjfacaanddi becupfacaand flowerfirm st54facashbewild-pagetacefeather-plume-spray-small34114centerpiece-feathers-emerald-green-spads-ostrichredcenterpiece-ostrich-feather-spadsblosfe182spwhosfe18spblackostrichplumewhosfe183prf3411234115yellowostrichfeathers34113341163411734110lime-green-ostrich-feathers-15-inchesparty-ostrich-feathers-fuchsiaroyal-blue-ostrich-featherpink-floral-centerpiece-featherscenterpiece-feathers-purple-ostrichred-ostrich-feathers-13-incheswhite-ostrich-feathers-13inches3411834119ledfliimuusevaflvaeitocyacledevliflujedewapeflanoaflsulodesysubmersibleled1https://s.yimg.com/aah/shopwildthings/feathers-ostrich-feathers-for-vases-more-73.jpghttps://s.yimg.com/aah/shopwildthings/feathers-ostrich-feathers-for-vases-more-74.jpg

We carry affordable ostrich spads in lengths that will range from about 29 inches to 32 inches each. The width or spread of each feather you order will be approximately 7 inches. Our white ostrich feather spads will each range in length from 23 inches to 26 inches. Because they are thinner than mature plumes, bleach absorption will vary. Some will appear white, while others will appear off-white in color. We think the range in shades only adds to the all-natural appeal of these white ostrich spads. Because of frequent damage in return shipping, we regret that this item is not returnable]]>vaflvaeitocy acledevliflu jedewapeflan oaflsulodesywild-pagerewophonmtv11https://s.yimg.com/aah/shopwildthings/featured-designer-tamara-wendt-led-lighting-decor-essentials-52.jpghttps://s.yimg.com/aah/shopwildthings/featured-designer-tamara-wendt-led-lighting-decor-essentials-53.jpg Tamara Wendt Design, is already wowing us with stunning looks for event planning fairs, not to mention a full season of weddings. We love to see the original uses that she finds for decor staples ~ to our way of thinking, it’s this ability to put fabulous pieces together in innovative ways, week after week, that really make a professional event planner worth every penny (and more). For instance in the main photo, take a look at the way that Tamara combines Chandeliers, feathers, candles, and LED lighting for a space that is high style and high energy. The cobalt blue downlighting shown here lends a dramatic nightclub feel to the event space, and the LED Uplighting is a subtle touch that makes a major impact with a minor effect on the budget. Hint: There are LEDs inside the vases with the ostrich feathers and in the chandelier riser centerpieces, which make a great counterpoint against the strong blue event lighting. If the whole chandelier-as-centerpiece-on-a-riser-with-LED thing sounds super-duper-complicated, check out these Centerpiece Kits and for a demo on how to take apart and put back together, check out this video. Totally doable, truly transformative, and budget-friendly to boot. In the 2nd photo, we love Tamara’s use of lighted spheres, LED-lit cubes, and this stunning indoor tent to create architectural interest and a soft, sexy space within a large ballroom. What a cool way to put your event’s distinctive stamp on a large venue and the tiers of warm candlelight from Votives and Wine Glass Vases work with cooler LED lighting in and around the tent. The 3rd photo shows another look at the formidable combination of bead curtains, chandeliers, and LED and event lighting. And the best part? These reusable items are some of the most cost effective event decor solutions that you can find. We know that Tamara’s a genius because we *know* that she takes many of the same basics and uses them to change the look of event space after event space, week after week. (Visit Tamara Wendt Design on Facebook, and you can see how she delivers custom, personalized events, week after week.) A lot of these are our products, and we’re *still* amazed at how different they look in the hands of a gifted event designer. Did you want to see a closeup of those gorgeous tables in the 4th photo? Who guessed crystal strands draped in a Manzanita Tree, embellished with hot pink florals and votives? And btw, we never get sick of hot pink. The final photo shows one last tablescape, using the same chandelier centerpiece kit and the same wine glass vases that you’ve seen in the photographs above, combined with a gorgeous suspended chandelier and luxe table linens. Totally romantic, and a completely different look in this setting. Whether you’re an experienced design professional, or you are just beginning to imagine that you can translate a unique vision for an event space, we know that you will find a multitude of uses for LED lighting and decor essentials at your events, week in and week out. We pride ourselves on supplying the best quality products along with great customer service, and we’d love to see how you use Shop Wild Things decor solutions in your events. All images courtesy of Tamara Wendt Designs; all of the weddings and events designed and coordinated by Tamara Wendt are produced by A One Event Rental.]]>chandelier2 baopledcanli wedding-backdrop-sheer-white-curtains eiffel-light-strand-white-6pcs feosfe centerpieceriserlomeyquinn32 centerpiece-riser-chrome-extra-tall white-2inch-wax-floating-candles-4pcs glass-candle-holders-set-long-stem-cylinder led-organza-curtain-warmwhite-12foot 30fololaocga trinpo4fetab1 pipe-and-drape-backdropswild-pagerewophonmtv11https://s.yimg.com/aah/shopwildthings/festivities-wedding-reception-decor-ideas-47.jpghttps://s.yimg.com/aah/shopwildthings/festivities-wedding-reception-decor-ideas-48.jpgIf you need to Decorate for a wedding reception, why not consider beaded curtains and chandeliers hung from the ceiling, around the room, behind the cake table, and behind the head table? They add tons of glitz and glamour to the room without competing with your theme colors. You can make our Crystal Beaded Curtains and Crystal Chandeliers any color you'd like by simply aiming your choice of colored light at them! If you use no colored light, they will just sparkle and shimmer as shown in these spectacular photos shared by Tina over at Festivities in Ormonde Beach, Florida. The ceiling treatment shown in the photos was made by Festivities using our beaded curtains and attaching the rods at the ends, but we also sell a ceiling drape and canopy that's ready to hang...see the links below! The lighting on top of the chandeliers that were used as centerpieces are our LED Light Discs. We also sell kits that include a Riser for your Chandelier Centerpiece. Below are many of the items used to create this beautiful event.chcch6lo chhu4timcr72 beloswla dibecu becedr ledlidiupvao oaflsulodesywild-pageprom-homecoming-dance-decorations1https://s.yimg.com/aah/shopwildthings/fiber-optic-clip-on-light-14-b-o-set-of-12-76.jpghttps://s.yimg.com/aah/shopwildthings/fiber-optic-clip-on-light-14-b-o-set-of-12-77.jpgFeathers, flowers, floral arrangements, wreaths, tree branches or light up Terrariums, clear vases and Cinderalla Carriages. Note: these are not waterproof. Lighting up Decor really doesn't get any easier - attach, toggle on, done! And it's amazing how this little light can make wedding and event centerpieces come to life. Place in a Glasss Dome with a single rose - simple and elegant! To replace the batteries, carefully slide your fingernail under the side holding the clip, and gently pry off the top.]]>stline vaflvaeitocy silkflowerswild-pagelimegreendecor3https://s.yimg.com/aah/shopwildthings/ficus-spray-25-bendable-greenery-branch-44.jpghttps://s.yimg.com/aah/shopwildthings/ficus-spray-25-bendable-greenery-branch-45.jpgThere is a minimum order of 3 sprays. The shorter stem on this branch allows it to be used in shallower vases like a Mermaid Vase, while letting the leafy stems dangle down. Flowers are such an essential element for weddings, special events and everyday decor, but adding greenery enhances any display and completes the visual. Top event planners and designers are taking advantage of every part of their venues by adding overhead floral chandeliers to completely surround guests in luscious natural foliage and this spray is an ideal addition for lavish draping designs. To create a perfect ceremony setting and photo backdrop, use this ficus branch on a Wedding Chuppah Gazebo that has pre-drilled holes, ready to hold an abundance of floral and greenery sprays. Beautiful, effortless, versatile and reusable. Just the kind of decor a busy planner or decorator dreams of!]]>artificialgreenery silkflowers vaflvaeitocy effectively-using-spectacular-silk-flowerswild-pagerewophonmtv11https://s.yimg.com/aah/shopwildthings/filling-the-air-with-the-greatest-of-ease-large-decor-items-52.jpghttps://s.yimg.com/aah/shopwildthings/filling-the-air-with-the-greatest-of-ease-large-decor-items-53.jpgCandles, as your intended watches from a dais embellished with crystal columns. Actually, you don't have to imagine: Just check out the effect that Colin Cowie achieved in the main photo. Using some of the same key elements ~ candlelight and square crystal columns ~ Colin Cowie ties the ceremony and reception areas together beautifully. Adding to the already stunning architecture of the room, these pieces set the stage for a grand affair. These crystal columns can be ordered in custom lengths to accentuate the structure of any classic or modern event space, and they're a great way to enhance the dramatic effect of high ceilings. A closeup of the Crystal Columns shows the way that color can be added with event lighting Ń one of the things we love about these columns is how versatile they are, taking on the color that you select. For event planners, they are the ultimate in reusable large scale event Decor. (We love the gorgeous custom design with the couple"s initials, too. Such a bold, timeless touch. We Southerners can't help but think that the monogram would look pretty swanky on pillows and towels, too.) we're suckers for Candlelight and ostrich feathers. Besides being stunning ways to fill giant venues effectively, they're extremely cost effective, as they're 100% reusable. Hello, jaws dropping *and* happy planet. In the last photo, an off-to-the-side view of the bar shows how well integrated the entire event"s Decor is. The effect of the event lighting is clear on the left side of this image. And we kinda think you can't go wrong with Ostrich Feathers in a bar. Whether you're working on your breakthrough event at an A-list venue, experimenting with portfolio work that will launch you into the stratosphere of event planning, or building a set of strategies to fill big spaces on a budget without looking like corners were sliced and diced, we think that large Decor items are staples that every planner should stockpile due to their versatility, value, and overall wow factor. Crystal columns and ostrich feathers are some of the most flexible, impactful, and all around stunning pieces that we carry. Throw in some candle light and a chandelier or ten, and you have an event to remember even for the most jaded VIP guests. Whether this is your first or your 101st wedding or event, we'd love to talk to you about how our stunning Decor staples can transform your venues while yielding fantastic value for your clients.]]>cylinder-vases-20inches floating-led-white-rose-candles-2pc-3inch 20footcrystalcolumnsquare crystal-hanging-column-beaded-strands-large-event-decor 6-inch-light-base-color-changing-with-remote 34114wild-pagerewophonmtv11https://s.yimg.com/aah/shopwildthings/firefly-occasions-calgary-ab-canada-beverly-hills-ca-27.jpghttps://s.yimg.com/aah/shopwildthings/firefly-occasions-calgary-ab-canada-beverly-hills-ca-28.jpg ]]>chbediduodbr clgecu dicrbecu12fe dicrbecu9lo beloswla ledlipucowirwild-pagerewophonmtv11https://s.yimg.com/aah/shopwildthings/five-diy-fall-centerpieces-that-are-high-on-style-and-easy-on-budgets-52.jpghttps://s.yimg.com/aah/shopwildthings/five-diy-fall-centerpieces-that-are-high-on-style-and-easy-on-budgets-53.jpg Centerpiece One: Candlelight, Nature, and Texture Meet We love the way that this long, layered centerpiece combines elements found in nature and at your local farmer"s market (small pumpkins and gourds, ferns, and berries) with tall ivory candles in varying sizes. Add a Burlap Runner and perhaps some moss and a few sprays for color and you have a lovely organic centerpiece that will last throughout autumn. No time for a total redo for Christmas? Replace the pumpkins with poinsettias and pinecones, and this pretty arrangement could stay put well into the new year. (PS: If you haven't read Anita"s blog, it's the kind that really sucks you inÉ Her words are genuine and her projects are inspiring in an in-my-next-life-I'll-refinish-my-own-wormy-chestnut-countertops kind of way.) Centerpiece Two: Modern Lines in a Spare Fall Centerpiece The simple, authentic feel of this centerpiece wins us over completely. No experience arranging florals is required, because the sturdy trio of pumpkins is a forgiving base for Tall Branches in a high vase. Add a bowl of nuts (or even acorns) for balance, and your table is ready for company. (Swap the pumpkins for some heavy Christmas balls, and this centerpiece can greet Santa in style.) Centerpiece Three: Traditional Pumpkins in Non-Traditional Colors For an original twist on a tried and true fall color scheme, we love these white pumpkins with fiery fall colors in the red and yellow Sprays or Beaded Garland and orange runner. Beads and votives complete this original interpretation of a classic fall table. Centerpiece Four: A Tempest in a Vase You can't beat this centerpiece for charming simplicity ~ we could assemble everything inside the vase in our yard right now. Well, if it weren't dark. Choose some pretty fall leaves and pinecones, a vase or three, and you have a delightful centerpiece. Best of all, label that vase when you pack your seasonal Decor away, and you can recreate this centerpiece on no budget at all next year. Centerpiece Five: An Array of Fall Goodies Finally, we love this layered take on a fall centerpiece. It has just the right balance of whimsy and weight, and we're suckers for a visually appealing hodgepodge of favorite things. (And for any display that includes striped candy sticks.) Combining a tall glass vase, branches and/or sprays, some votives, Table Scatter and pumpkin-filled stands is more doable when you have a model to go by, and InspiredByCharm provides a great example here. (We love to see patterns applied to burlap runners, and these shiny polkadots look like a reasonable DIY option.) So if our opening paragraph and the whole three-weeks-from-Thanksgiving-til-Christmas thing freaked you out a bit (as it did us when we realized, say, two days ago), we hope that we've redeemed ourselves by giving you some high impact, low cost ideas for dressing your table for the coming holidays.]]>jutetabletopperrectangle mosspadrectangle ga5felosetof6 ga5felosetof8 amaranthus-spray-green-39-inches trbrnabrbema cylinder-vases-20inches 12-real-wax-candles-in-glass-cups 34176 wooden-planter-box-brown-12inchwild-pageledupwawava11https://s.yimg.com/aah/shopwildthings/flame-lamp-battery-operated-amber-and-blue-tabletop-or-hanging-66.jpghttps://s.yimg.com/aah/shopwildthings/flame-lamp-battery-operated-amber-and-blue-tabletop-or-hanging-67.jpgThe awesome silk flame of this cool Flame Lamp is really set off by the Amber and Blue Colored LED lights. These lights create quite beautiful glow when you turn on the unit. An internal fan blows to move the silk and it really looks so much like a real flame. You AND your guests will do a double-take! The bowl 10" Wide x 4.5" tall. The Flame, when turned on, stands almost 8" tall. The The LED lights stay cool to the touch so you won't have to worry about anyone getting hot hands. The old style of these flame lamps used Halogen lights which got very hot. Our new flame lamp now comes with a flat-bottom bowl so that you can use it on the table. You'll also get a chain for hanging applications. This unit is battery operated with a 7 hour battery life on 4 D Batteries (batteries are not included). Create a super-exotic look for your next event or even in your home, office, or recreation room! You can also add a 6V DC Adapter for permanent installations. AC Adapter is not included but can be purchased at most hardware stores.acledevliflu ledlidiupvao flledcabaopwild-pagewhclde1https://s.yimg.com/aah/shopwildthings/small-floating-candles-bulk-weddings-24.jpghttps://s.yimg.com/aah/shopwildthings/small-floating-candles-bulk-weddings-25.jpgMirrors. Classy and exquisite, submerge flowers in a clear glass vase and float a candle or two on top. Easy and a great time saver for last minute get-togethers. You can also sit these on water jelly Decor, diamond confetti fill, or if using clear water, use colorful Submersible LED Lights to match your theme. If you have a larger vase, bowl or even a fountain, float candles and foam roses. How elegant!]]>flledcabaop hacaho vaflvaeitocywild-pagewhclde2https://s.yimg.com/aah/shopwildthings/shopwildthings-2-inch-floating-candles-26.jpghttps://s.yimg.com/aah/shopwildthings/shopwildthings-2-inch-floating-candles-27.jpgThere is a minimum order of 2 Sets, 4 Pieces per Set. Romantic floating candles create the perfect ambiance and the subtle glow looks dreamy floating on water or simply placed on Mirrors. Classy and exquisite, submerge flowers in a clear glass vase and float a candle or two on top. Easy and a great time saver for last minute get-togethers. You can also sit these on water jelly Decor, diamond confetti fill, or if using clear water, use colorful Submersible LED Lights to match your theme. If you have a larger vase, bowl or even a fountain, float candles and foam roses. How elegant!]]>flledcabaop hacaho vaflvaeitocywild-pagewhclde1https://s.yimg.com/aah/shopwildthings/floating-candles-shopwildthings-26.jpghttps://s.yimg.com/aah/shopwildthings/floating-candles-shopwildthings-27.jpgburn time is 7-8 hours. Romantic floating candles create the perfect ambiance and the subtle glow looks dreamy floating on water or simply placed on Mirrors. Classy and exquisite, submerge flowers in a clear glass vase and float a candle or two on top. Easy and a great time saver for last minute get-togethers. You can also sit these on water jelly Decor, diamond confetti fill, or if using clear water, use colorful Submersible LED Lights to match your theme. If you have a larger vase, bowl or even a fountain, float candles and foam roses. How elegant!]]>flledcabaop hacaho vaflvaeitocywild-pagewhclde2https://s.yimg.com/aah/shopwildthings/small-floating-candles-wholesale-25.jpghttps://s.yimg.com/aah/shopwildthings/small-floating-candles-wholesale-26.jpgThere is a minimum order of 2 Sets, 12 Pieces per Set. Romantic floating candles create the perfect ambiance and the subtle glow looks dreamy floating on water or simply placed on Mirrors. Classy and exquisite, submerge flowers in a clear glass vase and float a candle or two on top. Easy and a great time saver for last minute get-togethers. You can also sit these on water jelly Decor, diamond confetti fill, or if using clear water, use colorful Submersible LED Lights to match your theme. If you have a larger vase, bowl or even a fountain, float candles and foam roses. How elegant!]]>flledcabaop hacaho vaflvaeitocywild-pagewhclde2https://s.yimg.com/aah/shopwildthings/2-inch-floating-candles-bulk-packs-27.jpghttps://s.yimg.com/aah/shopwildthings/2-inch-floating-candles-bulk-packs-28.jpgThere is a minimum order of 2 Sets, 4 Pieces per Set. Romantic floating candles create the perfect ambiance and the subtle glow looks dreamy floating on water or simply placed on Mirrors. Classy and exquisite, submerge flowers in a clear glass vase and float a candle or two on top. Easy and a great time saver for last minute get-togethers. You can also sit these on water jelly Decor, diamond confetti fill, or if using clear water, use colorful Submersible LED Lights to match your theme. If you have a larger vase, bowl or even a fountain, float candles and foam roses. How elegant!]]>flledcabaop hacaho vaflvaeitocywild-pagewhclde1https://s.yimg.com/aah/shopwildthings/large-floating-candles-shopwildthings-26.jpghttps://s.yimg.com/aah/shopwildthings/large-floating-candles-shopwildthings-27.jpgburn time is 7-8 hours. Romantic floating candles create the perfect ambiance and the subtle glow looks dreamy floating on water or simply placed on Mirrors. Classy and exquisite, submerge flowers in a clear glass vase and float a candle or two on top. Easy and a great time saver for last minute get-togethers. You can also sit these on water jelly Decor, diamond confetti fill, or if using clear water, use colorful Submersible LED Lights to match your theme. If you have a larger vase, bowl or even a fountain, float candles and foam roses. How elegant!]]>flledcabaop hacaho vaflvaeitocywild-pagecolorfulcurtainsilverbendablebeadedcurtain1https://s.yimg.com/aah/shopwildthings/floating-confetti-beaded-curtains-86.jpghttps://s.yimg.com/aah/shopwildthings/floating-confetti-beaded-curtains-87.jpgOur festive confetti beaded curtains at ShopWildThings have bendable rods, which means they're a beaded curtain or a beaded column. Get the celebration started with these colorful strands of PVC acrylic squares and rectangles that make fun backdrops for wedding receptions and outdoor deck parties. Because these extraordinary confetti bead curtains have a bendable rod, you can bend them around columns, around staircases, around outside pavilion posts and around just about any stage set piece. Just use your imagination. At outdoor receptions, wrap these bending curtain rods with colorful confetti beads around tree trunks or concrete gateposts. At your weekend cabin or beach house, bend them around your fence gates or porch columns. They make amazing restaurant and nightclub focal points when you wrap our bendable bead curtains around inside support columns or service tables. You can just cut to make them to fit lower tables. Leading event planners use these attention-getting confetti-shape beaded curtains to decorate doorways and windows. Use them as charming curtains for doors or windows at galas and awards ceremonies. Celebrate a special event at your restaurant or retail store with confetti bead curtains in display areas or entrances. The curtain is 35 inches wide and 6 feet long, and it's pre-assembled with 7 strands of acrylic confetti spaced 3 inches apart on each curtain. The multiple sizes of the squares and rectangles range from 1 inch by 2 inch configurations to 3.5 inches by 3.5 inches in size. Choose white, metallic silver, multi-color curtains or a combination of black, silver and white curtain confetti. wild-pageshepherdshooks1https://s.yimg.com/aah/shopwildthings/floral-and-centerpiece-riser-39-chrome-silver-finish-76.jpghttps://s.yimg.com/aah/shopwildthings/floral-and-centerpiece-riser-39-chrome-silver-finish-77.jpgThis majestic 39" tall Centerpiece Riser has so many possibilities! It makes a fantastic statement as a focal point for event tables but also stands out beautifully as a floor unit. Use flameless LED candles, floral arrangements or top with a chandelier and LED floralytes or light discs. The diameter of the base is 8" and the bowl is 7.5" in diameter. There is a candle holder in the middle of the bowl which is 2.25" in diameter. This riser bears a resemblance to a trumpet and will add elegance and class wherever it's displayed. The entire unit easily comes apart in 4 pieces for storage. This item weighs just over 3 lbs.oaflsulodesy hacaho trees-and-floral tacewild-pagevaflvaeitocy1https://s.yimg.com/aah/shopwildthings/floral-and-chandelier-centerpiece-vase-riser-gold-27-45.jpghttps://s.yimg.com/aah/shopwildthings/floral-and-chandelier-centerpiece-vase-riser-gold-27-46.jpg
This tall floral centerpiece riser is 27" tall by 7 1/2" wide with a base footprint of 6 1/4". The vase is metal and provides the foundation for a successful event and delivers on reducing stressful decorating decisions and simplifying planning efforts! The inner measurements of the large bowl are 8 1/2" deep, 3 1/2" wide at the bottom and 7 1/4" wide at the top. This large bowl is the ideal vessel for draping silk floral sprays like Wisteria Blooms, Plumeria or Amaranthus as well as upright sprays like Silk Rose Bouquets, Hydrangea Blooms, Orchids and Tiger Lilies or surround a tall flameless candle with greenery and silky florals.

To use as a centerpiece riser, Silk or Foam Pomander Kissing Balls like Hydrangeas and fanciful ostrich feathers are effortless decorating options that also add height and color. Create a chandelier centerpiece by adding a chandelier on top which also provides a framework to hold floral Decor and lights. A Real Capiz Shell chandelier or a chandelier with clear beads like Avalon looks impressive atop this riser. Then after the event, you've got a chandelier and a vase that you can use separately!

This vase looks majestic sitting on the floor or on a Wedding Pillar Column to line an aisle and can also be used to hold your favorite bottle of bubbly but there are no drain holes. Multi-functional, no maintenance and fabulous looking! This is the kind of event product that you'll be proud to own!]]>
vaflvaeitocy ropokiba silkflowers feosfe trumpet-vase-centerpiece-riser-silver-27inches
This tall floral centerpiece riser is 27" tall by 7 1/2" wide with a base footprint of 6 1/4". The vase is metal and provides the foundation for a successful event and delivers on reducing stressful decorating decisions and simplifying planning efforts! The inner measurements of the large bowl are 8 1/2" deep, 3 1/2" wide at the bottom and 7 1/4" wide at the top. This large bowl is the ideal vessel for draping silk floral sprays like Wisteria Blooms, Plumeria or Amaranthus as well as upright sprays like Silk Rose Bouquets, Hydrangea Blooms, Orchids and Tiger Lilies or surround a tall flameless candle with silky florals.

To use as a centerpiece riser, Silk or Foam Pomander Kissing Balls and fanciful ostrich feathers are effortless decorating options that also add height and color. Create a chandelier centerpiece by adding a chandelier on top which also provides a framework to hold floral Decor and lights. Crystal chandeliers like April, Avalon, Ashlynn and Shimmy Silver look impressive atop this riser. Then after the event, you've got a chandelier and a vase that you can use separately!

This vase looks majestic sitting on the floor or on wedding pillar columns to line an aisle and can also be used to hold your favorite bottle of bubbly but there are no drain holes. Multi-functional, no maintenance and fabulous looking! This is the kind of event product that you'll be proud to own!]]>
vaflvaeitocy silkflowers trees-and-floral wearisma trumpet-vase-centerpiece-riser-gold-27inches
wild-pagerewophonmtv11https://s.yimg.com/aah/shopwildthings/floral-wedding-chandelier-centerpiece-22.jpghttps://s.yimg.com/aah/shopwildthings/floral-wedding-chandelier-centerpiece-23.jpgOutdoor Weddings and Jewel Toned Floral Chandeliers Floral chandeliers are a top trend at luxury weddings and events, and our workhorse structural pieces make this look gettable for new designers and experienced pros alike. With the right ShopWildThings floral chandelier as a base, you can dress up your next venue with custom floral creations at a variety of heights for maximum impact. Exuberant blooms in jewel tones contrast perfectly against the natural setting at the chic outdoor wedding in photo #2 above. A series of uber upscale orchid floral chandeliers is a gorgeous Decor element at the outdoor reception in Photo#3. Complemented by hanging raindrop glass candleholders above and a long, low floral runner on the table, these floral chandeliers take center stage without upstaging the centerpiece. Floral Chandeliers as Subtle Accents Sometimes, your already pretty space needs just a little je ne sais quoi. Except that we do sais quoi ~ floral chandeliers are a pretty, classic way to fill in ceremony and reception spaces with elegance that does not overwhelm. Floral swags and a floral chandelier in creams and pinks highlight the most important moment of the day without overwhelming the bride and groom, and they photograph perfectly. We love the floral chandeliers at staggered heights and how they add a pop of color and overall gorgeousness to any reception, and by hanging several of them low over table, you can maximize seating and conversation by eliminating the need for tabletop centerpieces. Making florals do double duty in this way is a secret to maximizing your clients" budgets, and there"s no better way to prove that a professional event designer is worth every penny than to take good care of the dollars entrusted to you. In Photo #5 close-up of this hydrangea and rose floral chandelier shows just how doable this look is with our floral chandeliers as your base. Floral chandeliers are one of those quiet worker bee pieces that don't take the spotlight, but that make your design work shine by facilitating show-stopping arrangements, efficient event setup, and myriad design concepts, week in and week out. And, shameless plug, you can learn more about how to use floral chandeliers and other tools of the trade at Sarah Campbell"s upcoming workshops. She is the brains behind Intrigue Designs, one of the best event firms in the industry ~ always innovating and always sharing knowledge. Check out Sarah"s teaching schedule here, and don't wait too longÉ Her workshops sell out on the regular. Intrigue Teaches Workshops Here Whether you need to build a top flight design warehouse, or to finish out your existing stock with a few key pieces, let us help you find the innovative Decor must that will make you money immediately. Our customer service folks are the nicest in the industry, and they're ready to help you place an order that will take your designs to the next level. Give us a call at 1-928-855-6075 and let us help you find the reusable, sustainable Decor products that will bring top shelf design within reach with premium quality, easy setup, breakdown, and storage, and ultimate design flexibility. We look forward to seeing how you use our pieces to make your clients" dreams come true. The items used in some of these photos were: Hayden Candle Chandelier Lulu Candle Chandelier Hanging Glass Teardrops Rachelle Candle Chandelier Floral Chandeliers ]]>shabbychicchandelier hwhcrcachla rablglcahose rcrhacachme silkflowers floral-walls-greenery-backdropswild-pagerewophonmtv11https://s.yimg.com/aah/shopwildthings/floral-canopy-customize-your-event-venue-using-faux-florals-14.jpghttps://s.yimg.com/aah/shopwildthings/floral-canopy-customize-your-event-venue-using-faux-florals-15.jpgCreate a Floral Wonderland Wedding Ceremony with Faux Blooms and a Statement Chandelier When the sky is the limit of your design creativity and a floral wonderland is your goal, take a page from this stunning playbook and wrap your ceremony in a bell jar of realistic faux florals. Wondering how to get this seemingly natural look within the limits of your venues? Let us introduce you to some of the hottest products to hit the event industry and show you how to put them into action at your next event. They are ready and waiting to ship from our huge warehouse of in stock products to become a blank canvas for your faux (or real) floral magic. If your venue offers infrastructure that can support a suspended floral chandelier, we bring you two easy to install options that will sell over and over again. Option 1 is the Mac Daddy version, six feet in diameter and fabulous in every way. Our floral chandelier frame has two tiers of metal and can support live or faux florals, suspended floral garlands, string curtains, candle holders, crystals… You get the idea. This is the Sampson of floral chandeliers, and he is ready to put that muscle to work at your next season of events.
6' Floral Chandelier Frame
Hanging Floral Garlands
Artificial Greenery
Multi-Arm Chandeliers
String Curtains
Light Curtains & Event Lighting Along the same lines but scaled back a tad, Option 2 is the JV version of a floral chandelier, about four feet in diameter and ready to support a single tier of faux florals along with a few well chosen suspended pieces.
4' Floral Chandelier Frame
Bouquets, Sprays & Garlands
Green Walls & Draping Sprays
Tiered Chandeliers
Event Lighting Finally, when your venue has nothing that you can use as a base for suspended florals, we suggest starting with Option 3: a chuppah gazebo structure. You can add faux florals and string curtains or suspended garlands and create a similar effect with absolutely no venue infrastructure. When you can make her dreams appear out of thin air, you’ll be a hero in the eyes of your client, who wants the enclosed floral wonderland without the details about venue infrastructure. Check out the Option 3 Links below for products to create this look out of thin air and open space.
Chuppah Gazebos & Arches
Bendable Stem Floral Garlands
Pomander Kissing Flower Balls
Sheer Draping Panels
Hanging Candle Holders
Beaded Crystal Garlands Love the image but don’t see quite the perfect option in our ready to use stock described above? Luckily, there’s an Option 4 that is in many ways the best of the best, with no compromises. We have the ability to custom fabricate any product that you need to get the effect that your client requires, and we do it all.the.time for huge names in the event design business. We love a challenge, and we think of ourselves like design therapists ~ give us a call, pour out your problems, help us understand exactly what’s missing in your design life, and we’ll create a solution that addresses the challenges you face. Better yet, we’ll do it on budget, on time, and with quality that you didn’t know still existed in our industry. Whether you need in stock products to create Options 1, 2, or 3, or you need an innovative and original custom solution, give the nicest customer service folks in the event business a call at 1-928-855-6075. We’re waiting to help you build the dream team of event décor products to serve your clients and your bottom line.]]>
ivory-flower-garland-8feet-flexible flowing-bridal-bouquet-spray-or-centerpiece whitechandelier12lights led-light-curtain-plug-in-pure-white-9ft overhead-banner-frame-2tier-hanging white-wedding-bouquet-dangling-flowers-44inch artificial-philodendron-leaf-5-pc-silk-garlands boxwood-greenery-wall-backdrop-panel crystal-diamondcut-3tier-chandelier 10x10-round-gazebo-mandap-hardware-kit adjustable-gazebo-pipe-frame-kit wedding-white-roses-flower-ball-kissing-balls-large-pomander wisteria-branch-spray-38inch-white
wild-pagegiant-oversized-silk-flowers11https://s.yimg.com/aah/shopwildthings/floral-centerpiece-riser-kit-adjustable-pick-colors-crystals-71.jpghttps://s.yimg.com/aah/shopwildthings/floral-centerpiece-riser-kit-adjustable-pick-colors-crystals-72.jpgFuller on Top Picture on Right: We used all of the strands to hang around the frame of the White Upsy Daisy Stand. We cut the garlands in half and wire tied them to the top of the frame. We then used some of the leftover pieces to wrap the top of the frame to hide it. We also added some of our High Quality Acrylic Garland Strands to add some glitz, but those are optional and do not come with this kit. We only needed about 10 feet of Acrylic Garland to make an impact on this piece, and most of our Garlands come in bags that are 30 feet long each! Cover the Base: Picture on Left: Simply use less strands up top and save about 1/2 of one garland to hide wrap the base! The Upsy Daisy White Centerpiece Riser is a Staple for most of our Event Planners. It is affordable, attractive, and able to be reused in a bunch of different designs! We also offer it in a CHROME color. Included in your Kit: 3 Pcs Floral Garlands 2 Flower Styles available in 4 different colors each. Select your color from the Swatch Charts and then use the drop-down menu that says "Choose Flower" 1 Pc of your choice: - White Upsy Daisy Floral Riser (34-60" Tall) - Chrome Riser (22-60" Tall) - add $20.00 for Chrome Please use the drop-down menu that says Choose Riser to select which color riser you'd like. The floral style used in the Main Image is Floral Style #1 Fuchsia on the White Upsy Daisy Riser. The images below show these same Flower Styles made into large chandeliers. We can do this for you as well - but these are intended to show you what these flowers look like a little better than the color swatches. Flower Style #2 in Orchid Pink (Shown hanging with our High Quality Acrylic Garlands.) Flower Style #2 in Ivory (Shown hanging with our High Quality Acrylic Garlands.) Flower Style #2 in Purple (Shown hanging with our High Quality Acrylic Garlands.) ]]>floral-chandeliers centerpiece-riser-chrome-extra-tall 70103 silkflowers gaandst peacglwild-pagesilk-flower-garlands11https://s.yimg.com/aah/shopwildthings/floral-chandelier-crystals-8-flower-choices-easy-diy-kit-21.jpghttps://s.yimg.com/aah/shopwildthings/floral-chandelier-crystals-8-flower-choices-easy-diy-kit-22.jpgAnticipate assembly to take no more than 30 minutes for your first Kit, and it will go faster after you play with one a bit. We will send detailed instructions with your Kit. The author here (Katie) can barely tie her shoes, and she's got these down to a science and can assemble them in about 15 minutes flat! Purchased separately, the total of the items in this kit would be from $141.99 to $149.99, depending on the floral garland chosen! Hang them over tables, at the top of tents, and more. Anywhere that you need glamour and color can benefit from this fabulous Floral Chandelier! Scroll down to see large images of the 2 Flower Choices and 8 Colors Available! The image showing the purple chandelier gives one example of how this kit can be configured. Want longer or alternating strands of florals? Cut the garlands at different lengths. Want more crystals or no crystals? Just buy another bag, if you'd like. The frame for this chandelier is 24" in diameter. There are 2 tiers, so you can hang the garlands on both levels and have a fabulous depth effect. The Floral Chandelier that we made is 2 Feet Wide x 4 Feet Long. We'll include the instructions to make the exact Floral Chandelier that you see in the main image with the Purple Chandelier. Included in your kit: 6 Super-Premium Floral Garlands - you will cut these to make strands (We personally hand select these garlands for their quality and beauty. Our stringent quality standards are adhered to by all of our factories. There is "ShopWildThings Quality" and then "Standard Quality". We pay more because of our requirements, because we'd rather that you jump out of your skin with joy over our products.) 1 Wire Frame with already attached sturdy Easy-Wires for VERY quick attachments 1 Bag of High Quality Acrylic Crystal Garlands, 30 Feet Long (read above about our quality. Same goes for our Crystals as our Flower Garlands) 1 Hanging Chain Kit (assembled, just add to frame) 1 Instruction Sheet for Quick Assembly Please make your selection of Flower Style & Color by using the Photo Swatches showing Flower Style 1 and Flower Style 2. Flower Style #2 in Orchid Pink Flower Style #2 in Ivory Flower Style #1 in Purple ]]>floral-chandelier floral-centerpiece-kit faceted-crystal-balls-40mm-clear-drops 70102 silkflowerswild-pagesilk-flower-garlands11https://s.yimg.com/aah/shopwildthings/orchid-floral-chandelier-with-crystal-strands-over-5-1-2-feet-long-choose-flower-color-87.jpghttps://s.yimg.com/aah/shopwildthings/orchid-floral-chandelier-with-crystal-strands-over-5-1-2-feet-long-choose-flower-color-88.jpg Custom Orders: Give us a call if you need a completely different flower, color, a mix of colors, a different style of Crystal Bead, or a different size - be it a different frame, a multi-tiered frame, or even a Floral Chandelier in sizes up to 6 Feet in Diameter! Want a Square Floral Chandelier? We do that too! Our in-house fabrication studio employs a host of American Workers who do the MOST amazing high-quality designs! This Floral Chandelier is made-to-order. Please allow 10 business days prior to shipping. If your order is needed sooner, please enter notes into the comments section of your order. ]]>floral-chandelier-event-kit floral-centerpiece-kit beculane silkflowers artificialgreenery floral-chandelier-wedding-decor-ideas-designswild-pagecurtains-and-columns1floral-chandelierwhite-flower-chandelier-wedding-decorfloral-chandelier-event-kitflower-chandeler-column-kitcrystal-hanging-column-beaded-strands-large-event-decorsilkflowersbecrcohangingcandlefloral-walls-greenery-backdropsartificialgreeneryropokibagaandstropesiropebsfloral-centerpiece-kitsilk-flower-garlandsgiant-oversized-silk-flowers1https://s.yimg.com/aah/shopwildthings/hanging-floral-chandeliers-columns-82.jpghttps://s.yimg.com/aah/shopwildthings/hanging-floral-chandeliers-columns-83.jpgFloral Chandeliers are ALL THE RAGE right now and from small venues to large, inside or out, top event planners are creating the most awesome floral displays that make our jaws drop! So, we've gathered together everything you need to make your vision a reality! From fluffy flower sprays and garlands to full and lush greenery vines and even crystal strands, we've stocked every color and style to please even the most discerning planner. And, don't forget the hardware! We have adjustable risers, hanging frames, arches and pipe and drape sets. If florals aren't your cup of tea, let us help. We can make ANY size Floral Chandelier for you CUSTOM. Choose from any of our dozens of floral garlands, let us know your colors, if you would like crystals added, what size you need...and we'll take care of the rest! Call us with your needs and ideas: 928-855-6075. Our in-house studio books up quickly, call today!wild-pagerewophonmtv11https://s.yimg.com/aah/shopwildthings/floral-chandeliers-from-top-shelf-trend-to-timelessness-32.jpghttps://s.yimg.com/aah/shopwildthings/floral-chandeliers-from-top-shelf-trend-to-timelessness-33.jpgFloral Chandeliers Speak Luxury Over Your Wedding
When they first appeared on the wedding and event scene a few years ago, floral chandeliers were a hot trend that cutting edge professional event designers were using to set their events apart from the pack. Fast-forward a few years, and they’re almost expected at the most fabulous weddings and events. Now, the most admired designers are refining their techniques and expanding their repertoires to continue to use floral chandeliers in innovative, jaw-dropping installations at a variety of price points and aesthetics. Let us take you inside a floral chandelier to see the components that make these gorgeous behemoths possible. In the main photo, this monochromatic floral chandelier plays with texture by including a variety of types of flowers, creating an overall shape that evokes peonies by using different Suspended Florals. A quick look inside the structure of the chandelier reveals the two tier aluminum display frame that makes floral chandelier installation infinitely easier, and our faux florals put this sort of wow! feature in reach of many budgets. If your bride can afford live florals and your crew can handle the setup, of course the effect is nothing short of breathtaking, and our Aluminum Frame is the perfect starting point. And if you’re looking for a great place to trim expenses to meet your brides’ budgets, adding a faux floral setup like this one to your arsenal is a proposition with great ROI. Suspended Floral Centerpieces or Personal Floral Chandeliers? Either Way, They’re A Showstopper
In the 2nd photo, what could be more decadent than outdoor tables with their own floral chandeliers? This sumptuous waterfront wedding sets a new bar for elegance with Cascading Orchids floating above a long, low centerpiece of roses and tropical florals. If your budget – and the climate and weather conditions – allow live blooms to give you the look and the bottom line that you want, we support you 100%. But if windy oceanfront weather and/or your inner frugal warrior lead you to consider faux florals, our selection of Huge Individual Blooms, cascading suspended florals, and super reliable, well built risers might just be the solution. As a designer, you can sell this basic setup customized with color, flower styles (our risers work equally well with real and faux options, btw), candles, and anything else that your brides desire. Wondering exactly what is “next level” when your bride starts at fabulous? As in the 3rd photo, a room-sized floral chandelier coordinated with low tabletop centerpieces must be on the short list for a stratospheric level of bridal game. In this over the top luxury wedding by I Am Flower, we just cannot get enough of the variegated, low hanging floral chandelier combined with large floral centerpieces on Crystal Risers and supersized crystal candelabras. Truly, this is luxury at its finest ~ and most decadent. Capitalize on Your Venue’s Existing Structures by Accenting Them with Faux Floral Chandeliers
When your venue has great bones ~ and a yummy rustic shelter like the one in the 4th photo ~ suspended faux florals in a bold color are such an easy way to create a floral chandelier. We love the icicle effect of the pink florals combined with the Sparkling Crystal Candelabras and mercury glass votives on the tabletop. Literally, your only additional expense will be replacing the candles, and you can sell this setup to bride after bride for years to come. We pride ourselves on spotting the trends that have style and staying power. For professional event designers with a long-term business vision, we supply the best quality in both the sexy showstopper event décor items, and in the unsung hero project helping tools that keep those show ponies looking great at event after event. Whether you’re just now able to invest in the building blocks for your first floral chandelier or suspended centerpiece, or you’re ready to take your setups to the next level, we are your go to source for information, quality products, and friendly customer service. So give the nicest customer service folks in the event business a call at 1-928-855-6075, and let us help you offer your brides the looks that they want at prices that will provide top shelf value on top flight looks.]]>
6ft-round-metal-chandelier-frame-2tier silk-flower-garlands silkflowers wedding-backdrop-sheer-white-curtains floral-holder-centerpiece-riser-adjustable-height phala-orchid-white-50inches green-vine-ivory-berries-floral-spray-40inches giant-silk-flowers-for-props tall-wisteria-spray-blush-pink-ivory-38in tall-cherry-blossom-floral-spray-cream-pink crystal-candelabra-centerpiece-riser-15inch crystal-candelabra-5arm-hurricane-globes-40inches crystal-candelabra-wedding-centerpieces
wild-pageexlocu1https://s.yimg.com/aah/shopwildthings/floral-display-stand-and-riser-silver-chrome-28-5-high-66.jpghttps://s.yimg.com/aah/shopwildthings/floral-display-stand-and-riser-silver-chrome-28-5-high-67.jpgThis centerpiece or floor standing flower pot is awesome! The chrome is shiny and reflective and will pick up on the tiniest amount of light in the room. The overall height is 29", the base is 6.5" in diameter and bowl is 8" in diameter and 3.5" deep. Make a centerpiece or floor display using a submersible LED Floralyte mixed with some colorful strands of gems and crystal sprays! Quick - easy - beautiful!hanging-wedding-flower-pot-chrome-29inch hanging-silver-flower-pot-with-beads tace weevde oaflsulodesywild-pagewhclde11https://s.yimg.com/aah/shopwildthings/floral-display-stands-victory-white-set-of-4-19-1-2-w-x-40-49-60-71-1-2-h-26.jpghttps://s.yimg.com/aah/shopwildthings/floral-display-stands-victory-white-set-of-4-19-1-2-w-x-40-49-60-71-1-2-h-27.jpgOversized Silk, Foam or Paper Flower Heads and fill in with leafy sprays, ivy or Baby's Breath Bouquets. For a daintier look, we have a huge selection of silk florals in an array of colors and styles. From dangling sprays and garlands to Flowering Tree Branches, the bendable stems easily fit into the grids of the frame. Curtain hooks are great for dangling crystal pendants and with a frame chocked full of flowers, they'll easily be concealed. If you prefer using pre-made flower walls or green wall mats, you'll just need to do a bit of measuring to determine the amount of walls you'll need. Coverage will vary depending on the mats you choose and please remember that all of our flower and greenery mats can easily be cut to fit the frame. Here's an example using a 10 1/2" Square Boxwood Mat: the smallest frame would need 8 mats and the largest would need 14. Say you're using an average sized flower wall like this 19" x 25 1/2" Rose & Hydrangea Mat, the small frame would need 1 1/2 mats and the large frame would need 3 mats. Using a boxwood background with flowers on top is an elegant and colorful combination and since all of our mats are attached to a plastic grid framework, simple poke the flower stem through the boxwood and attach to the back of the frame. Weave flower garlands, tulle, beaded crystal strands, string lights or butterfly garlands through the grids. For weddings and events, parties and celebrations, for hotel lobbies or for unique store displays, "Victory" will be yours with this set of 4, metal display stands! If you're not using the legs, please subtract 3/4" from the height stated above.]]>silkflowers floral-walls-greenery-backdrops artificialgreenery giant-oversized-silk-flowerswild-pagediycraftflfashmego10flfashmesi10flfashwh10yaflfashir10yaflfashgrgr10flfashliblflfashmebl10flfashyeflfashmecepflfashcep10yflfashorflfashredflfashmeredflfashblflfashsaflfashbrflfashmetuflfashmpusequinfabricdiycraftflfasecoavartificialgreeneryfloral-walls-greenery-backdrops1https://s.yimg.com/aah/shopwildthings/floral-fabric-sheeting-19-colors-available-117.jpghttps://s.yimg.com/aah/shopwildthings/floral-fabric-sheeting-19-colors-available-118.jpgPlease see the short video at the bottom of this page for further information on this fantastic product! Cover tables. Cover walls. Decorate a parade float. Staple it to a wall. Hang it in a window. Cover a ceiling. Use it in a display window and place product on it. This stuff is amazing, and a hot new trend in event decor. Used together with our beaded curtains, chandeliers, diamond confetti and chair ties, you will be able to create a spectacular event or display. Floral Fabric Sheeting is fire rated. Just let us know if you are decorating a venue that requires a specification sheet to meet fire code requirements. Simply apply it like wrapping paper to props and boxes. Hang it using double-sided tape to walls and banner stands. Unlike fabrics, you will never have to hem it or worry about a frayed edge. Ready to install right out of the box! Click on the colors below to order. Because of frequent damage in return shipping, we regret that this item is not returnable]]>wild-pagerewophonmtv11https://s.yimg.com/aah/shopwildthings/floral-fabric-sheeting-creative-decorating-ideas-26.jpghttps://s.yimg.com/aah/shopwildthings/floral-fabric-sheeting-creative-decorating-ideas-27.jpg]]>flfasecoavwild-pageflfadefa11https://s.yimg.com/aah/shopwildthings/floral-fabric-sheeting-black-45.jpghttps://s.yimg.com/aah/shopwildthings/floral-fabric-sheeting-black-46.jpgBecause of frequent damage in return shipping, we regret that this item is not returnable ]]>wild-pageflfadefa11https://s.yimg.com/aah/shopwildthings/floral-fabric-sheeting-brown-42.jpghttps://s.yimg.com/aah/shopwildthings/floral-fabric-sheeting-brown-43.jpgBecause of frequent damage in return shipping, we regret that this item is not returnable ]]>wild-pageflfadefa11https://s.yimg.com/aah/shopwildthings/floral-fabric-sheeting-grass-green-45.jpghttps://s.yimg.com/aah/shopwildthings/floral-fabric-sheeting-grass-green-46.jpgBecause of frequent damage in return shipping, we regret that this item is not returnable ]]>wild-pageflfadefa11https://s.yimg.com/aah/shopwildthings/floral-fabric-sheeting-iridescent-35.jpghttps://s.yimg.com/aah/shopwildthings/floral-fabric-sheeting-iridescent-36.jpgBecause of frequent damage in return shipping, we regret that this item is not returnable ]]>wild-pageflfadefa11https://s.yimg.com/aah/shopwildthings/floral-fabric-sheeting-light-blue-46.jpghttps://s.yimg.com/aah/shopwildthings/floral-fabric-sheeting-light-blue-47.jpgBecause of frequent damage in return shipping, we regret that this item is not returnable ]]>wild-pageflfadefa11https://s.yimg.com/aah/shopwildthings/floral-fabric-sheeting-medium-blue-46.jpghttps://s.yimg.com/aah/shopwildthings/floral-fabric-sheeting-medium-blue-47.jpgBecause of frequent damage in return shipping, we regret that this item is not returnable ]]>wild-pageflfadefa11https://s.yimg.com/aah/shopwildthings/floral-fabric-sheeting-metallic-cerise-pink-46.jpghttps://s.yimg.com/aah/shopwildthings/floral-fabric-sheeting-metallic-cerise-pink-47.jpgBecause of frequent damage in return shipping, we regret that this item is not returnable ]]>wild-pageflfadefa11https://s.yimg.com/aah/shopwildthings/floral-fabric-sheeting-metallic-gold-50.jpghttps://s.yimg.com/aah/shopwildthings/floral-fabric-sheeting-metallic-gold-51.jpgBecause of frequent damage in return shipping, we regret that this item is not returnable ]]>wild-pageflfadefa11https://s.yimg.com/aah/shopwildthings/floral-fabric-sheeting-metallic-purple-45.jpghttps://s.yimg.com/aah/shopwildthings/floral-fabric-sheeting-metallic-purple-46.jpgBecause of frequent damage in return shipping, we regret that this item is not returnable ]]>wild-pageflfadefa11https://s.yimg.com/aah/shopwildthings/floral-fabric-sheeting-metallic-red-42.jpghttps://s.yimg.com/aah/shopwildthings/floral-fabric-sheeting-metallic-red-43.jpgBecause of frequent damage in return shipping, we regret that this item is not returnable ]]>wild-pageflfadefa11https://s.yimg.com/aah/shopwildthings/floral-fabric-sheeting-metallic-silver-61.jpghttps://s.yimg.com/aah/shopwildthings/floral-fabric-sheeting-metallic-silver-62.jpgBecause of frequent damage in return shipping, we regret that this item is not returnable ]]>wild-pageflfadefa11https://s.yimg.com/aah/shopwildthings/floral-fabric-sheeting-metallic-turquoise-43.jpghttps://s.yimg.com/aah/shopwildthings/floral-fabric-sheeting-metallic-turquoise-44.jpgBecause of frequent damage in return shipping, we regret that this item is not returnable ]]>wild-pageflfadefa11https://s.yimg.com/aah/shopwildthings/floral-fabric-sheeting-orange-45.jpghttps://s.yimg.com/aah/shopwildthings/floral-fabric-sheeting-orange-46.jpgBecause of frequent damage in return shipping, we regret that this item is not returnable ]]>wild-pageflfadefa11https://s.yimg.com/aah/shopwildthings/floral-fabric-sheeting-pink-transformers-3-46.jpghttps://s.yimg.com/aah/shopwildthings/floral-fabric-sheeting-pink-transformers-3-47.jpgBecause of frequent damage in return shipping, we regret that this item is not returnable ]]>wild-pageflfadefa11https://s.yimg.com/aah/shopwildthings/floral-fabric-sheeting-red-45.jpghttps://s.yimg.com/aah/shopwildthings/floral-fabric-sheeting-red-46.jpgBecause of frequent damage in return shipping, we regret that this item is not returnable ]]>wild-pageflfadefa11https://s.yimg.com/aah/shopwildthings/floral-fabric-sheeting-sand-42.jpghttps://s.yimg.com/aah/shopwildthings/floral-fabric-sheeting-sand-43.jpgBecause of frequent damage in return shipping, we regret that this item is not returnable ]]>wild-pageflfadefa11https://s.yimg.com/aah/shopwildthings/floral-fabric-sheeting-white-45.jpghttps://s.yimg.com/aah/shopwildthings/floral-fabric-sheeting-white-46.jpgBecause of frequent damage in return shipping, we regret that this item is not returnable ]]>wild-pageflfadefa11https://s.yimg.com/aah/shopwildthings/floral-fabric-sheeting-yellow-45.jpghttps://s.yimg.com/aah/shopwildthings/floral-fabric-sheeting-yellow-46.jpgBecause of frequent damage in return shipping, we regret that this item is not returnable ]]>wild-pageledupwawavaeiffel-light-strand-warm-white-6pcseiffel-light-strand-white-6pcseiffel-light-strand-blue-6pcseiffel-light-strand-violet-6pcseiffel-lights-silver-wire-20-leds-warmwhite-crbatthanging-floral-light-warm-white-10pcshanging-floral-light-white-10pcsfliiorledliwfliiamyeledlfliigrledliwfliiteledliwfliirledliwifliipiledliwflgrledli1tiflteledli1tiflamledli1tivaflvaeitocysubmersibleledshallleditponpaacledreledorbsledlidiupvaostlinewarm-white-led-saucerledlipucowirled-vase-light-6inch-round-rgb-with-remote6-inch-light-base-color-changing-with-remoteled-vase-light-6inch-round-warm-whiteled-vase-light-6inch-round-pure-whiteled-centerpiece-vase-light-with-remote-4inch-rgb3-inch-vase-light-base-rgb-with-remote-waterproofblackbaseledlight6inchrgblyteringrgb28eil8ledlidibeil6ledlidibledvaselightse4lubaopunliwaterproof-led-vase-light-with-remote-whitelyteringwhite6inchled-vase-light-round-4inch-warm-whiteled-vase-light-round-4inch-whitelargesubmersibleledlightemaxi32rgbwhitebaseledlightrgbledupwawavaoaflsulodesyledicecubaopflledcabaoplightingledvaselightlargeled-vase-light-square-battery-operated20057triple-led-submersible-domed-rgb20062double-led-submersible-warm-whitedouble-led-submersible-cool-whitesubrdobufliisubmersibleledcoolwhitesingle-led-submersible-warm-whitesingle-led-submersible-cool-whitesingle-led-submersible-ambersingle-led-submersible-redsingle-led-submersible-pinksingle-led-submersible-purplesingle-led-submersible-bluesingle-led-submersible-tealsuflwhledli1suflgrledli1suflteledli1suflpiledli1suflorledli1suflrgbredgr200502005120052200532005420055fiber-optic-party-lights-with-clip-14inches1https://s.yimg.com/aah/shopwildthings/led-floralyte-ii-multiple-use-lights-many-colors-48.jpghttps://s.yimg.com/aah/shopwildthings/led-floralyte-ii-multiple-use-lights-many-colors-49.jpgLet our Floralyte II LED lights from ShopWildThings create razzle-dazzle lighting effects at your special event. Light up stage props. Create breathtaking light effects for centerpieces, ice sculptures, flower arrangements or posh party tables set with our elegant LED candles. Hang these Floralyte II saucers, or drop them into vases. These versatile little lights are each 1 1/2 inches long, 3/4 of an inch wide and about 1/4-inch thick. Our New DazzLED Line of Event Lighting is exclusively made for ShopWildThings! Each light has an on/off switch. Our Floralyte II LED bulbs are available in sets of 10. Choose red, orange, amber/yellow, blue, green, white, teal, purple or pink. We also carry bulbs that change colors from red to green to blue. Browse our photographs that showcase these dazzling little lights in use inside centerpieces, as flower vase Decorations or as set Decor .vaflvaeitocywild-pagewedding-decorblush-pink-flower-wall-kit-portable-backdropgreen-flower-wall-event-backdrop-64sqftpink-wedding-backdrop-flower-wall-kitwedding-photo-backdrop-flower-wall-kitwhite-flower-wall-backdrop-kitpurple-flower-wall-backdrop-kit-64sqftflower-wall-backdrop-kit-cream-hydrangeashuge-red-flower-wall-event-backdrop-kit8ft-by-8ft-floral-wall-backdrop-kitsilver-flower-wall-kit-portable-backdropflower-wall-kit-gold-portable-backdropportable-flower-wall-kit-event-backdropblush-pink-flower-wall-kit-event-backdrop64sqft-red-flower-wall-kit-event-backdropivory-flower-wall-kit-64sqft-backdrop8ftsq-flower-wall-event-backdrop-kitpurple-flower-wall-kit-8ft-square-backdrophuge-flower-wall-backdrop-portable-kitblack-flower-wall-backdrop-kit-8ftsqcoral-pink-flower-wall-backdrop-kit-8ft-by-8ft8ft-cream-silk-rose-flower-wall-kithydrangea-flower-wall-backdrop-kitartificial-boxwood-fire-rated-greenery-wallfire-rated-greenery-backdrop-wall-kitboxwood-greenery-wall-backdrop-kit-8ft8ft-lush-mixed-greenery-backdrop-wall-kitflower-wall-kit-pink-roses-8ft-portable-backdrop8ft-flower-wall-backdrop-kit-pink-roses8ft-portable-flower-wall-backdrop-kitflower-wall-backdrop-kit-8ft64sqft-complete-flower-wall-backdrop-kitfloral-walls-greenery-backdrops1https://s.yimg.com/aah/shopwildthings/flowerwallkits-58.jpghttps://s.yimg.com/aah/shopwildthings/flowerwallkits-59.jpgThe most popular question we get from our customers about Flower Wall panels is "How many flower wall panels do you need to make an 8 Foot Wide by 8 Foot Tall Flower wall backdrop?" We have assembled a bunch of fabulous KITS that will allow you to stop doing math and start doing backdrops! Buy our Flower Wall Kits that will have enough panels to cover your space. The kit will also include the backdrop fencing to attach the backdrop panels to as well as Wire Ties. If you have your own 8' Tall Pipe and Drape stand, then great! But if you need a stand, we also offer those as an Add-On item. You'll get everything in the original kit as well as 8' tall Pipe Uprights, Base Plates with Pins, and Cross Bars. floral-walls-greenery-backdropswild-pageoaflsulodesy1https://s.yimg.com/aah/shopwildthings/floral-chandelier-centerpiece-riser-48-white-metal-57.jpghttps://s.yimg.com/aah/shopwildthings/floral-chandelier-centerpiece-riser-48-white-metal-58.jpgGarlands and Greenery to create a two-level floral extravaganza! This is also wonderful for holding our Pomander Rose and Hydrangea Balls! The design of the basket is ideal not only for holding a multitude of florals, garlands, greenery and Pomander Kissing Balls but consider using it as a riser for large, flameless pillar candles (minimum 5 1/2" in diameter) or to create an elevated table chandelier. If you like sparkle like we like sparkle then you'll love the framework of the basket as it can easily be used to dangle tons of sparkling crystal beads! As a floor riser, a Crystal Beaded Chandelier like Avalon or Ashlynn with a 6 1/4" inner ring sits perfectly atop the basket with plenty of room for an LED light saucer if you'd like to downlight the chandelier. Dress the bottom with flower garlands and greenery for a knockout floral chandelier accent piece! Easy to store and transport, this riser weighs 2 lbs. and can be stored in a space measuring 24" x 4" x 12.5".]]>oaflsulodesy silk-flower-garlands ropokiba event-chandeliers-tieredcat-image-test1wild-pagewhclde1https://s.yimg.com/aah/shopwildthings/flower-ball-14-premium-silk-roses-peonies-hydrangeas-cream-35.jpghttps://s.yimg.com/aah/shopwildthings/flower-ball-14-premium-silk-roses-peonies-hydrangeas-cream-36.jpgWe expect this item to come Back in Stock shortly. Often we have a comparable product that we can quickly help you find, so please give us a call at 928.855.6075. If you'd prefer this item only, please enter your email address in the box where it says "Notify me when this item is back in stock!" and as soon as this item is made orderable on our site, you'll get an email from us!

Premium Silk Pomander Kissing Ball With Huge Roses, Peonies and Hydrangeas 13 3/4" Wide Cream Flower Ball Splits into 2 Halves With this 1 flower ball, you really get 2 toppers for vases or risers! In the main photo, the leftmost shot shows the whole flower ball on a vase while the upper right shows half of the ball sitting on a vase. The bottom right shows the ball split into 2 halves. So very elegant and so very full, our Cream Flower Ball is 13 3/4" in diameter and bursting with lovely silk flowers that are huge and luscious! Each ball splits into 2 halves so you can use this Pomander Kissing Ball in a variety of ways. There are 37 huge blooms consisting of 18 roses that measure 4" wide by 3" tall and 19 peonies that measure 3 1/2" wide by 3" tall! The remainder of the ball is filled with 2 1/2" wide hydrangeas and the variety and size of flowers makes this ball visually and texturally outstanding! There are green silk leaves popping from the base of the flowers and with a little fluffing, you cannot see the plastic grid frame at all. This is one grandiose item that splits into 2 superior products! At just under 14", this flower ball is pretty substantial and makes jaw-dropping wedding and event Decor. For maximum impact centerpiece Decor, place an entire ball atop a tall Mermaid Vase or split the ball into 2 halves to gain twice the decorating capacity. There are pegs and holes on the frame so you can split and reconnect the halves as much as needed. Each half sphere can sit on a Crystal Beaded Centerpiece Riser, elevated cake stand or use to outline the cake table. These half balls can also be attached to flower walls or stapled to actual walls. For outdoor ceremonies, hang from trees, tents and arches or create a romantic aisle walkway by placing on tall Floral Risers. For hanging, the plastic grid framework makes it easy to attach a ribbon or if you'd like to make them a bit more ritzy, attach Ivory Pearl or Sparkling Crystal Garland Strands. These floral accent balls are so easy to work with and give a huge visual impact. We offer our Flower Pomander Kissing Balls in many sizes, colors and styles so you're sure to find the perfect flowers to fit your occasion! We shopped and shopped trying to find quality flower balls that are jam-packed with blooms that look like real flowers, without the expense of fresh flowers. We feel that the superiority and style of these decorative accent pieces will meet the needs of discerning buyers with a cost that won't break the bank!]]>
vaflvaeitocy catrfatr floral-walls-greenery-backdrops
Create incredible wedding and event centerpiece designs without having to fuss and stress over messing with real flowers and the shocking cost of real flowers. These are ideal for flower girls to carry down the aisle and you can also line your aisle by hanging these from shepherds' hooks. For centerpieces, you can hang them from manzanita trees, place them on a vase or simply lay on a table. They are also great for adding lots of color and volume to wedding arches. The inside frame is plastic so it's very easy to string the balls together to form a garland and you can dress them up by adding strands of beads or crystal pendants.

With the wide variety of colors and sizes, it's easy to match any color scheme or party theme with these marvelous, colorful blooms of nature!]]>
ropokiba shepherdshooks vaflvaeitocy
Create incredible wedding and event centerpiece designs without having to fuss and stress over messing with real flowers and the shocking cost of real flowers. These are ideal for flower girls to carry down the aisle and you can also line your aisle by hanging these from shepherds' hooks. For centerpieces, you can hang them from manzanita trees, place them on a vase or simply lay on a table. They are also great for adding lots of color and volume to wedding arches. The inside frame is plastic so it's very easy to string the balls together to form a garland and you can dress them up by adding strands of beads or crystal pendants.

With the wide variety of colors and sizes, it's easy to match any color scheme or party theme with these marvelous, colorful blooms of nature!]]>
ropokiba shepherdshooks vaflvaeitocy
Create incredible wedding and event centerpiece designs without having to fuss and stress over messing with real flowers and the shocking cost of real flowers. These are ideal for flower girls to carry down the aisle and you can also line your aisle by hanging these from shepherds' hooks. For centerpieces, you can hang them from manzanita trees, place them on a vase or simply lay on a table. They are also great for adding lots of color and volume to wedding arches. The inside frame is plastic so it's very easy to string the balls together to form a garland and you can dress them up by adding strands of beads or crystal pendants.

With the wide variety of colors and sizes, it's easy to match any color scheme or party theme with these marvelous, colorful blooms of nature!]]>
ropokiba shepherdshooks tree-and-vases vaflvaeitocy
wild-pagepinks1https://s.yimg.com/aah/shopwildthings/flower-ball-silk-hydrangea-pomander-kissing-ball-10-pink-29.jpghttps://s.yimg.com/aah/shopwildthings/flower-ball-silk-hydrangea-pomander-kissing-ball-10-pink-30.jpgCenterpiece Vase. For table Decor or floor accent pieces, place atop a Floral Riser. These are ideal for flower girls to carry down the aisle and you can also line your aisle by hanging these from Shepherds' Hooks. They are also great for adding lots of color and volume to wedding arches and the interior framework makes it easy to attach glitzy crystal garland strands or crystal pendants. Handy, practical, versatile with no mess or hassle! What a great element to have close at hand for those last minute emergencies when you need to create a stylish focal piece, and of course these kissing balls can be used over and over!]]>ropokiba vaflvaeitocy silkflowerswild-pagereddecor1https://s.yimg.com/aah/shopwildthings/flower-ball-silk-hydrangea-pomander-kissing-ball-10-red-69.jpghttps://s.yimg.com/aah/shopwildthings/flower-ball-silk-hydrangea-pomander-kissing-ball-10-red-70.jpgCenterpiece Vase. For table Decor or floor accent pieces, place atop a Floral Riser. These are ideal for flower girls to carry down the aisle and you can also line your aisle by hanging these from Shepherds' Hooks. They are also great for adding lots of color and volume to wedding arches and the interior framework makes it easy to attach glitzy crystal garland strands or crystal pendants. Handy, practical, versatile with no mess or hassle! What a great element to have close at hand for those last minute emergencies when you need to create a stylish focal piece, and of course these kissing balls can be used over and over!]]>ropokiba vaflvaeitocy silkflowerswild-pagebltude1https://s.yimg.com/aah/shopwildthings/flower-ball-silk-hydrangea-pomander-kissing-ball-10-blue-100.jpghttps://s.yimg.com/aah/shopwildthings/flower-ball-silk-hydrangea-pomander-kissing-ball-10-blue-101.jpg
Create incredible wedding and event centerpiece designs without having to fuss and stress over messing with real flowers and the shocking cost of real flowers. These are ideal for flower girls to carry down the aisle and you can also line your aisle by hanging these from shepherds' hooks. For centerpieces, you can hang them from manzanita trees, place them on a vase or simply lay on a table. They are also great for adding lots of color and volume to wedding arches. The inside frame is plastic so it's very easy to string the balls together to form a garland and you can dress them up by adding strands of beads or crystal pendants.

With the wide variety of colors and sizes, it's easy to match any color scheme or party theme with these marvelous, colorful blooms of nature!]]>
ropokiba shepherdshooks trees-and-floral
wild-pagepinks1https://s.yimg.com/aah/shopwildthings/flower-ball-silk-hydrangea-pomander-kissing-ball-12-pink-26.jpghttps://s.yimg.com/aah/shopwildthings/flower-ball-silk-hydrangea-pomander-kissing-ball-12-pink-27.jpgTall Centerpiece Vase. To accentuate an aisle or for a floor accent piece, place atop a Floral Riser. These are ideal for flower girls to carry down the aisle and you can also line your aisle by hanging these from Shepherds' Hooks. They are also great for adding lots of color and volume to wedding arches and the interior framework makes it easy to attach glitzy crystal garland strands or crystal pendants. Handy, practical, versatile with no mess or hassle! What a great element to have close at hand for those last minute emergencies when you need to create a stylish focal piece, and of course these kissing balls can be used over and over!]]>ropokiba vaflvaeitocy silkflowerswild-pagepinks1https://s.yimg.com/aah/shopwildthings/flower-ball-silk-hydrangea-pomander-kissing-ball-6-fuchsia-42.jpghttps://s.yimg.com/aah/shopwildthings/flower-ball-silk-hydrangea-pomander-kissing-ball-6-fuchsia-43.jpg
With the wide variety of colors and sizes, it's easy to match any color scheme or party theme with these marvelous, colorful blooms of nature!]]>
ropokiba shepherdshooks trees-and-floral
With the wide variety of colors and sizes, it's easy to match any color scheme or party theme with these marvelous, colorful blooms of nature!]]>
ropokiba shepherdshooks tree-and-vases vaflvaeitocy
With the wide variety of colors and sizes, it's easy to match any color scheme or party theme with these marvelous, colorful blooms of nature!]]>
ropokiba shepherdshooks vaflvaeitocy
With the wide variety of colors and sizes, it's easy to match any color scheme or party theme with these marvelous, colorful blooms of nature!]]>
ropokiba shepherdshooks vaflvaeitocy
With the wide variety of colors and sizes, it's easy to match any color scheme or party theme with these marvelous, colorful blooms of nature!]]>
ropokiba shepherdshooks trees-and-floral
With the wide variety of colors and sizes, it's easy to match any color scheme or party theme with these marvelous, colorful blooms of nature!]]>
ropokiba shepherdshooks vaflvaeitocy
With the wide variety of colors and sizes, it's easy to match any color scheme or party theme with these marvelous, colorful blooms of nature!]]>
ropokiba shepherdshooks tree-and-vases vaflvaeitocy
With the wide variety of colors and sizes, it's easy to match any color scheme or party theme with these marvelous, colorful blooms of nature!]]>
ropokiba shepherdshooks trees-and-floral
With the wide variety of colors and sizes, it's easy to match any color scheme or party theme with these marvelous, colorful blooms of nature!]]>
ropokiba shepherdshooks tree-and-vases vaflvaeitocy
wild-pagewhclde1https://s.yimg.com/aah/shopwildthings/flower-ball-silk-hydrangea-pomander-kissing-ball-8-ivory-48.jpghttps://s.yimg.com/aah/shopwildthings/flower-ball-silk-hydrangea-pomander-kissing-ball-8-ivory-49.jpgSmaller Vase giving you twice the value! The interior plastic framework is pretty flexible so you can gently smoosh the edges and place inside the vase. For flower wall backdrops, use the separate halves to spell out a special message or design a monogram. Flower balls are so easy to use in centerpieces, adding a sophisticated touch of elegance for weddings and events. Place inside Cinderella carriages or Crown decorations for those specialty themed parties or top off a Tall Vase to create eye-catching table accent pieces. These are ideal for flower girls to carry down the aisle and you can also line your aisle by hanging these from Shepherds' Hooks. They are also great for adding lots of color and volume to wedding arches and the interior framework makes it easy to attach glitzy crystal garland strands or crystal pendants. Handy, practical, versatile with no mess or hassle! What a great element to have close at hand for those last minute emergencies when you need to create a stylish focal piece, and of course these kissing balls can be used over and over!]]>ropokiba vaflvaeitocy silkflowers shepherdshookswild-pagepinks1https://s.yimg.com/aah/shopwildthings/flower-ball-silk-hydrangea-pomander-kissing-ball-8-pink-26.jpghttps://s.yimg.com/aah/shopwildthings/flower-ball-silk-hydrangea-pomander-kissing-ball-8-pink-27.jpgSmaller Vase giving you twice the value! The interior plastic framework is pretty flexible so you can gently smoosh the edges and place inside the vase. For flower wall backdrops, use the separate halves to spell out a special message or design a monogram. Flower balls are so easy to use in centerpieces, adding a sophisticated touch of elegance for weddings and events. Place inside Cinderella carriages or Crown decorations for those specialty themed parties or top off a Tall Vase to create eye-catching table accent pieces. These are ideal for flower girls to carry down the aisle and you can also line your aisle by hanging these from Shepherds' Hooks. They are also great for adding lots of color and volume to wedding arches and the interior framework makes it easy to attach glitzy crystal garland strands or crystal pendants. Handy, practical, versatile with no mess or hassle! What a great element to have close at hand for those last minute emergencies when you need to create a stylish focal piece, and of course these kissing balls can be used over and over!]]>ropokiba silkflowers shepherdshooks vaflvaeitocywild-pagepinks1https://s.yimg.com/aah/shopwildthings/flower-ball-silk-hydrangea-pomander-kissing-ball-8-blush-pink-28.jpghttps://s.yimg.com/aah/shopwildthings/flower-ball-silk-hydrangea-pomander-kissing-ball-8-blush-pink-29.jpgSmaller Vase giving you twice the value! The interior plastic framework is pretty flexible so you can gently smoosh the edges and place inside the vase. For flower wall backdrops, use the separate halves to spell out a special message or design a monogram. Flower balls are so easy to use in centerpieces, adding a sophisticated touch of elegance for weddings and events. Place inside Cinderella carriages or Crown decorations for those specialty themed parties or top off a Tall Vase to create eye-catching table accent pieces. These are ideal for flower girls to carry down the aisle and you can also line your aisle by hanging these from Shepherds' Hooks. They are also great for adding lots of color and volume to wedding arches and the interior framework makes it easy to attach glitzy crystal garland strands or crystal pendants. Handy, practical, versatile with no mess or hassle! What a great element to have close at hand for those last minute emergencies when you need to create a stylish focal piece, and of course these kissing balls can be used over and over!]]>ropokiba silkflowers shepherdshooks vaflvaeitocywild-pagereddecor1https://s.yimg.com/aah/shopwildthings/flower-ball-silk-hydrangea-pomander-kissing-ball-8-red-28.jpghttps://s.yimg.com/aah/shopwildthings/flower-ball-silk-hydrangea-pomander-kissing-ball-8-red-29.jpgSmaller Vase giving you twice the value! The interior plastic framework is pretty flexible so you can gently smoosh the edges and place inside the vase. For flower wall backdrops, use the separate halves to spell out a special message or design a monogram. Flower balls are so easy to use in centerpieces, adding a sophisticated touch of elegance for weddings and events. Place inside Cinderella carriages or Crown decorations for those specialty themed parties or top off a Tall Vase to create eye-catching table accent pieces. These are ideal for flower girls to carry down the aisle and you can also line your aisle by hanging these from Shepherds' Hooks. They are also great for adding lots of color and volume to wedding arches and the interior framework makes it easy to attach glitzy crystal garland strands or crystal pendants. Handy, practical, versatile with no mess or hassle! What a great element to have close at hand for those last minute emergencies when you need to create a stylish focal piece, and of course these kissing balls can be used over and over!]]>ropokiba vaflvaeitocy silkflowers shepherdshookswild-pagewhclde1https://s.yimg.com/aah/shopwildthings/flower-ball-silk-rose-pomander-kissing-ball-10-5-ivory-56.jpghttps://s.yimg.com/aah/shopwildthings/flower-ball-silk-rose-pomander-kissing-ball-10-5-ivory-57.jpg
We offer our Flower Pomander Kissing Balls in 4 1/2", 6", 8 1/2" and 10 1/2" diameters. Try mixing the sizes and colors! The Roses are gloriously beautiful and full! We shopped and shopped trying to find Rose Balls that looked like real roses, didn't look cheap, but did not have the price tag of fresh flowers. We feel that this style will meet the needs of discerning buyers without a cost that will break the bank.]]>
trees-and-floral ropokiba shepherdshooks tace
We offer our Flower Pomander Kissing Balls in 4 1/2", 6", 8 1/2" and 10 1/2" diameters. Try mixing the sizes and colors! The Roses are gloriously beautiful and full! We shopped and shopped trying to find Rose Balls that looked like real roses, didn't look cheap, but did not have the price tag of fresh flowers. We feel that this style will meet the needs of discerning buyers without a cost that will break the bank.]]>
trees-and-floral ropokiba shepherdshooks tace
wild-pagewhclde1https://s.yimg.com/aah/shopwildthings/flower-ball-silk-rose-pomander-kissing-ball-4-5-ivory-55.jpghttps://s.yimg.com/aah/shopwildthings/flower-ball-silk-rose-pomander-kissing-ball-4-5-ivory-56.jpgOur Kissing Pomander Balls come in a huge variety of colors and are covered in high quality silk roses and are ready to be a key decorating element in your upcoming special day! Hang Pomanders from Shepherd's Hooks, from Manzanita Centerpiece Trees, or from Branches and Sprays in your floral Decor. Top a Vase with a Rose Ball and hang strands of our Crystals from them. Use the attached matching Satin Ribbon to hang them up if you'd like, or remove it and add a strand of pearls (we sell inexpensive Rolls of Pearls!) to hang them from. We think you could also really "fancy them up" by adding a short portion of Crystal Garland and attaching a Crystal Pendant to the bottom. If you'd like our help with this, just give us a call! We offer our Flower Pomander Kissing Balls in 4 1/2", 6", 8 1/2" and 10 1/2" diameters. Try mixing the sizes and colors! The Roses are gloriously beautiful and full! We shopped and shopped trying to find Rose Balls that looked like real roses, didn't look cheap, but did not have the price tag of fresh flowers. We feel that this style will meet the needs of discerning buyers without a cost that will break the bank.trees-and-floral ropokiba shepherdshooks tacewild-pagewhclde1https://s.yimg.com/aah/shopwildthings/flower-ball-silk-rose-pomander-kissing-ball-4-5-white-56.jpghttps://s.yimg.com/aah/shopwildthings/flower-ball-silk-rose-pomander-kissing-ball-4-5-white-57.jpgOur Kissing Pomander Balls come in a huge variety of colors and are covered in high quality silk roses and are ready to be a key decorating element in your upcoming special day! Hang Pomanders from Shepherd's Hooks, from Manzanita Centerpiece Trees, or from Branches and Sprays in your floral Decor. Top a Vase with a Rose Ball and hang strands of our Crystals from them. Use the attached matching Satin Ribbon to hang them up if you'd like, or remove it and add a strand of pearls (we sell inexpensive Rolls of Pearls!) to hang them from. We think you could also really "fancy them up" by adding a short portion of Crystal Garland and attaching a Crystal Pendant to the bottom. If you'd like our help with this, just give us a call! We offer our Flower Pomander Kissing Balls in 4 1/2", 6", 8 1/2" and 10 1/2" diameters. Try mixing the sizes and colors! The Roses are gloriously beautiful and full! We shopped and shopped trying to find Rose Balls that looked like real roses, didn't look cheap, but did not have the price tag of fresh flowers. We feel that this style will meet the needs of discerning buyers without a cost that will break the bank.trees-and-floral ropokiba shepherdshooks tacewild-pagelimegreendecor1https://s.yimg.com/aah/shopwildthings/flower-ball-silk-rose-pomander-kissing-ball-6-apple-green-146.jpghttps://s.yimg.com/aah/shopwildthings/flower-ball-silk-rose-pomander-kissing-ball-6-apple-green-147.jpgOur Kissing Pomander Balls come in a huge variety of colors and are covered in high quality silk roses and are ready to be a key decorating element in your upcoming special day! Hang Pomanders from Shepherd's Hooks, from Manzanita Centerpiece Trees, or from Branches and Sprays in your floral Decor. Top a Vase with a Rose Ball and hang strands of our Crystals from them. Use the attached matching Satin Ribbon to hang them up if you'd like, or remove it and add a strand of pearls (we sell inexpensive Rolls of Pearls!) to hang them from. We think you could also really "fancy them up" by adding a short portion of Crystal Garland and attaching a Crystal Pendant to the bottom. If you'd like our help with this, just give us a call! We offer our Flower Pomander Kissing Balls in 4 1/2", 6", 8 1/2" and 10 1/2" diameters. Try mixing the sizes and colors! The Roses are gloriously beautiful, and full and about 4" wide. We shopped and shopped trying to find Rose Balls that looked like real roses, didn't look cheap, but did not have the price tag of fresh flowers. We feel that this style will meet the needs of discerning buyers without a cost that will break the bank.shepherdshooks rollsofbeads peacgl gaandstwild-pagebltude1https://s.yimg.com/aah/shopwildthings/flower-ball-silk-rose-pomander-kissing-ball-6-blue-140.jpghttps://s.yimg.com/aah/shopwildthings/flower-ball-silk-rose-pomander-kissing-ball-6-blue-141.jpgshepherdshooks rollsofbeads peacgl gaandstwild-pagepinks1https://s.yimg.com/aah/shopwildthings/flower-ball-silk-rose-pomander-kissing-ball-6-coral-205.jpghttps://s.yimg.com/aah/shopwildthings/flower-ball-silk-rose-pomander-kissing-ball-6-coral-206.jpgOur Kissing Pomander Balls come in a huge variety of colors and are covered in high quality silk roses and are ready to be a key decorating element in your upcoming special day! Hang Pomanders from Shepherd's Hooks, from Manzanita Centerpiece Trees, or from Branches and Sprays in your floral Decor. Top a Vase with a Rose Ball and hang strands of our Crystals from them. Use the attached matching Satin Ribbon to hang them up if you'd like, or remove it and add a strand of pearls (we sell inexpensive Rolls of Pearls!) to hang them from. We think you could also really "fancy them up" by adding a short portion of Crystal Garland and attaching a Crystal Pendant to the bottom. If you'd like our help with this, just give us a call! We offer our Flower Pomander Kissing Balls in 4 1/2", 6", 8 1/2" and 10 1/2" diameters. Try mixing the sizes and colors! The Roses are gloriously beautiful, and full and about 4" wide. We shopped and shopped trying to find Rose Balls that looked like real roses, didn't look cheap, but did not have the price tag of fresh flowers. We feel that this style will meet the needs of discerning buyers without a cost that will break the bank.shepherdshooks rollsofbeads peacgl gaandstwild-pagereddecor1https://s.yimg.com/aah/shopwildthings/flower-ball-silk-rose-pomander-kissing-ball-6-fuchsia-158.jpghttps://s.yimg.com/aah/shopwildthings/flower-ball-silk-rose-pomander-kissing-ball-6-fuchsia-159.jpgOur Kissing Pomander Balls come in a huge variety of colors and are covered in high quality silk roses and are ready to be a key decorating element in your upcoming special day! Hang Pomanders from Shepherd's Hooks, from Manzanita Centerpiece Trees, or from Branches and Sprays in your floral Decor. Top a Vase with a Rose Ball and hang strands of our Crystals from them. Use the attached matching Satin Ribbon to hang them up if you'd like, or remove it and add a strand of pearls (we sell inexpensive Rolls of Pearls!) to hang them from. We think you could also really "fancy them up" by adding a short portion of Crystal Garland and attaching a Crystal Pendant to the bottom. If you'd like our help with this, just give us a call! We offer our Flower Pomander Kissing Balls in 4 1/2", 6", 8 1/2" and 10 1/2" diameters. Try mixing the sizes and colors! The Roses are gloriously beautiful, and full and about 4" wide. We shopped and shopped trying to find Rose Balls that looked like real roses, didn't look cheap, but did not have the price tag of fresh flowers. We feel that this style will meet the needs of discerning buyers without a cost that will break the bank.shepherdshooks rollsofbeads peacgl gaandstwild-pagegolddecor1https://s.yimg.com/aah/shopwildthings/flower-ball-silk-rose-pomander-kissing-ball-6-gold-57.jpghttps://s.yimg.com/aah/shopwildthings/flower-ball-silk-rose-pomander-kissing-ball-6-gold-58.jpgOur Kissing Pomander Balls come in a huge variety of colors and are covered in high quality silk roses and are ready to be a key decorating element in your upcoming special day! Hang Pomanders from Shepherd's Hooks, from Manzanita Centerpiece Trees, or from Branches and Sprays in your floral Decor. Top a Vase with a Rose Ball and hang strands of our Crystals from them. Use the attached matching Satin Ribbon to hang them up if you'd like, or remove it and add a strand of pearls (we sell inexpensive Rolls of Pearls!) to hang them from. We think you could also really "fancy them up" by adding a short portion of Crystal Garland and attaching a Crystal Pendant to the bottom. If you'd like our help with this, just give us a call! We offer our Flower Pomander Kissing Balls in 4 1/2", 6", 8 1/2" and 10 1/2" diameters. Try mixing the sizes and colors! The Roses are gloriously beautiful, and full and about 3" wide. We shopped and shopped trying to find Rose Balls that looked like real roses, didn't look cheap, but did not have the price tag of fresh flowers. We feel that this style will meet the needs of discerning buyers without a cost that will break the bank.ropokiba shepherdshooks rollsofbeads peacgl gaandstwild-pagelimegreendecor1https://s.yimg.com/aah/shopwildthings/flower-ball-silk-rose-pomander-kissing-ball-6-ivory-218.jpghttps://s.yimg.com/aah/shopwildthings/flower-ball-silk-rose-pomander-kissing-ball-6-ivory-219.jpgOur Kissing Pomander Balls come in a huge variety of colors and are covered in high quality silk roses and are ready to be a key decorating element in your upcoming special day! Hang Pomanders from Shepherd's Hooks, from Manzanita Centerpiece Trees, or from Branches and Sprays in your floral Decor. Top a Vase with a Rose Ball and hang strands of our Crystals from them. Use the attached matching Satin Ribbon to hang them up if you'd like, or remove it and add a strand of pearls (we sell inexpensive Rolls of Pearls!) to hang them from. We think you could also really "fancy them up" by adding a short portion of Crystal Garland and attaching a Crystal Pendant to the bottom. If you'd like our help with this, just give us a call! We offer our Flower Pomander Kissing Balls in 4 1/2", 6", 8 1/2" and 10 1/2" diameters. Try mixing the sizes and colors! The Roses are gloriously beautiful, and full and about 4" wide. We shopped and shopped trying to find Rose Balls that looked like real roses, didn't look cheap, but did not have the price tag of fresh flowers. We feel that this style will meet the needs of discerning buyers without a cost that will break the bank.shepherdshooks rollsofbeads peacgl gaandstwild-pagereddecor1https://s.yimg.com/aah/shopwildthings/flower-ball-silk-rose-pomander-kissing-ball-6-orange-108.jpghttps://s.yimg.com/aah/shopwildthings/flower-ball-silk-rose-pomander-kissing-ball-6-orange-109.jpgOur Kissing Pomander Balls come in a huge variety of colors and are covered in high quality silk roses and are ready to be a key decorating element in your upcoming special day! Hang Pomanders from Shepherd's Hooks, from Manzanita Centerpiece Trees, or from Branches and Sprays in your floral Decor. Top a Vase with a Rose Ball and hang strands of our Crystals from them. Use the attached matching Satin Ribbon to hang them up if you'd like, or remove it and add a strand of pearls (we sell inexpensive Rolls of Pearls!) to hang them from. We think you could also really "fancy them up" by adding a short portion of Crystal Garland and attaching a Crystal Pendant to the bottom. If you'd like our help with this, just give us a call! We offer our Flower Pomander Kissing Balls in 4 1/2", 6", 8 1/2" and 10 1/2" diameters. Try mixing the sizes and colors! The Roses are gloriously beautiful, and full and about 4" wide. We shopped and shopped trying to find Rose Balls that looked like real roses, didn't look cheap, but did not have the price tag of fresh flowers. We feel that this style will meet the needs of discerning buyers without a cost that will break the bank.shepherdshooks rollsofbeads peacgl gaandstwild-pagereddecor1https://s.yimg.com/aah/shopwildthings/flower-ball-silk-rose-pomander-kissing-ball-6-pink-210.jpghttps://s.yimg.com/aah/shopwildthings/flower-ball-silk-rose-pomander-kissing-ball-6-pink-211.jpgOur Kissing Pomander Balls come in a huge variety of colors and are covered in high quality silk roses and are ready to be a key decorating element in your upcoming special day! Hang Pomanders from Shepherd's Hooks, from Manzanita Centerpiece Trees, or from Branches and Sprays in your floral Decor. Top a Vase with a Rose Ball and hang strands of our Crystals from them. Use the attached matching Satin Ribbon to hang them up if you'd like, or remove it and add a strand of pearls (we sell inexpensive Rolls of Pearls!) to hang them from. We think you could also really "fancy them up" by adding a short portion of Crystal Garland and attaching a Crystal Pendant to the bottom. If you'd like our help with this, just give us a call! We offer our Flower Pomander Kissing Balls in 4 1/2", 6", 8 1/2" and 10 1/2" diameters. Try mixing the sizes and colors! The Roses are gloriously beautiful, and full and about 4" wide. We shopped and shopped trying to find Rose Balls that looked like real roses, didn't look cheap, but did not have the price tag of fresh flowers. We feel that this style will meet the needs of discerning buyers without a cost that will break the bank.shepherdshooks rollsofbeads peacgl gaandstwild-pagepurplestuff1https://s.yimg.com/aah/shopwildthings/flower-ball-silk-rose-pomander-kissing-ball-6-purple-323.jpghttps://s.yimg.com/aah/shopwildthings/flower-ball-silk-rose-pomander-kissing-ball-6-purple-324.jpgOur Kissing Pomander Balls come in a huge variety of colors and are covered in high quality silk roses and are ready to be a key decorating element in your upcoming special day! Hang Pomanders from Shepherd's Hooks, from Manzanita Centerpiece Trees, or from Branches and Sprays in your floral Decor. Top a Vase with a Rose Ball and hang strands of our Crystals from them. Use the attached matching Satin Ribbon to hang them up if you'd like, or remove it and add a strand of pearls (we sell inexpensive Rolls of Pearls!) to hang them from. We think you could also really "fancy them up" by adding a short portion of Crystal Garland and attaching a Crystal Pendant to the bottom. If you'd like our help with this, just give us a call! We offer our Flower Pomander Kissing Balls in 4 1/2", 6", 8 1/2" and 10 1/2" diameters. Try mixing the sizes and colors! The Roses are gloriously beautiful, and full and about 4" wide. We shopped and shopped trying to find Rose Balls that looked like real roses, didn't look cheap, but did not have the price tag of fresh flowers. We feel that this style will meet the needs of discerning buyers without a cost that will break the bank.shepherdshooks rollsofbeads peacgl gaandstwild-pageropokiba1https://s.yimg.com/aah/shopwildthings/flower-ball-silk-rose-pomander-kissing-ball-6-red-296.jpghttps://s.yimg.com/aah/shopwildthings/flower-ball-silk-rose-pomander-kissing-ball-6-red-297.jpgOur Kissing Pomander Balls come in a huge variety of colors and are covered in high quality silk roses and are ready to be a key decorating element in your upcoming special day! Hang Pomanders from Shepherd's Hooks, from Manzanita Centerpiece Trees, or from Branches and Sprays in your floral Decor. Top a Vase with a Rose Ball and hang strands of our Crystals from them. Use the attached matching Satin Ribbon to hang them up if you'd like, or remove it and add a strand of pearls (we sell inexpensive Rolls of Pearls!) to hang them from. We think you could also really "fancy them up" by adding a short portion of Crystal Garland and attaching a Crystal Pendant to the bottom. If you'd like our help with this, just give us a call! We offer our Flower Pomander Kissing Balls in 4 1/2", 6", 8 1/2" and 10 1/2" diameters. Try mixing the sizes and colors! The Roses are gloriously beautiful, and full and about 4" wide. We shopped and shopped trying to find Rose Balls that looked like real roses, didn't look cheap, but did not have the price tag of fresh flowers. We feel that this style will meet the needs of discerning buyers without a cost that will break the bank.shepherdshooks rollsofbeads peacgl gaandstwild-pageropokiba1https://s.yimg.com/aah/shopwildthings/flower-ball-silk-rose-pomander-kissing-ball-6-royal-blue-277.jpghttps://s.yimg.com/aah/shopwildthings/flower-ball-silk-rose-pomander-kissing-ball-6-royal-blue-278.jpgshepherdshooks rollsofbeads peacgl gaandstwild-pageropokiba1https://s.yimg.com/aah/shopwildthings/flower-ball-silk-rose-pomander-kissing-ball-6-silver-57.jpghttps://s.yimg.com/aah/shopwildthings/flower-ball-silk-rose-pomander-kissing-ball-6-silver-58.jpgOur Kissing Pomander Balls come in a huge variety of colors and are covered in high quality silk roses and are ready to be a key decorating element in your upcoming special day! Hang Pomanders from Shepherd's Hooks, from Manzanita Centerpiece Trees, or from Branches and Sprays in your floral Decor. Top a Vase with a Rose Ball and hang strands of our Crystals from them. Use the attached matching Satin Ribbon to hang them up if you'd like, or remove it and add a strand of pearls (we sell inexpensive Rolls of Pearls!) to hang them from. We think you could also really "fancy them up" by adding a short portion of Crystal Garland and attaching a Crystal Pendant to the bottom. If you'd like our help with this, just give us a call! We offer our Flower Pomander Kissing Balls in 4 1/2", 6", 8 1/2" and 10 1/2" diameters. Try mixing the sizes and colors! The Roses are gloriously beautiful, and full and about 3" wide. We shopped and shopped trying to find Rose Balls that looked like real roses, didn't look cheap, but did not have the price tag of fresh flowers. We feel that this style will meet the needs of discerning buyers without a cost that will break the bank.ropokiba shepherdshooks rollsofbeads peacgl gaandstwild-pagebltude1https://s.yimg.com/aah/shopwildthings/flower-ball-silk-rose-pomander-kissing-ball-6-turquoise-105.jpghttps://s.yimg.com/aah/shopwildthings/flower-ball-silk-rose-pomander-kissing-ball-6-turquoise-106.jpgOur Kissing Pomander Balls come in a huge variety of colors and are covered in high quality silk roses and are ready to be a key decorating element in your upcoming special day! Hang Pomanders from Shepherd's Hooks, from Manzanita Centerpiece Trees, or from Branches and Sprays in your floral Decor. Top a Vase with a Rose Ball and hang strands of our Crystals from them. Use the attached matching Satin Ribbon to hang them up if you'd like, or remove it and add a strand of pearls (we sell inexpensive Rolls of Pearls!) to hang them from. We think you could also really "fancy them up" by adding a short portion of Crystal Garland and attaching a Crystal Pendant to the bottom. If you'd like our help with this, just give us a call! We offer our Flower Pomander Kissing Balls in 4 1/2", 6", 8 1/2" and 10 1/2" diameters. Try mixing the sizes and colors! The Roses are gloriously beautiful, and full and about 4" wide. We shopped and shopped trying to find Rose Balls that looked like real roses, didn't look cheap, but did not have the price tag of fresh flowers. We feel that this style will meet the needs of discerning buyers without a cost that will break the bank.shepherdshooks rollsofbeads peacgl gaandstwild-pageyellowdecor1https://s.yimg.com/aah/shopwildthings/flower-ball-silk-rose-pomander-kissing-ball-6-yellow-215.jpghttps://s.yimg.com/aah/shopwildthings/flower-ball-silk-rose-pomander-kissing-ball-6-yellow-216.jpgOur Kissing Pomander Balls come in a huge variety of colors and are covered in high quality silk roses and are ready to be a key decorating element in your upcoming special day! Hang Pomanders from Shepherd's Hooks, from Manzanita Centerpiece Trees, or from Branches and Sprays in your floral Decor. Top a Vase with a Rose Ball and hang strands of our Crystals from them. Use the attached matching Satin Ribbon to hang them up if you'd like, or remove it and add a strand of pearls (we sell inexpensive Rolls of Pearls!) to hang them from. We think you could also really "fancy them up" by adding a short portion of Crystal Garland and attaching a Crystal Pendant to the bottom. If you'd like our help with this, just give us a call! We offer our Flower Pomander Kissing Balls in 4 1/2", 6", 8 1/2" and 10 1/2" diameters. Try mixing the sizes and colors! The Roses are gloriously beautiful, and full and about 4" wide. We shopped and shopped trying to find Rose Balls that looked like real roses, didn't look cheap, but did not have the price tag of fresh flowers. We feel that this style will meet the needs of discerning buyers without a cost that will break the bank.shepherdshooks rollsofbeads peacgl gaandstwild-page1https://s.yimg.com/aah/shopwildthings/flower-ball-silk-rose-pomander-kissing-ball-8-5-coral-140.jpghttps://s.yimg.com/aah/shopwildthings/flower-ball-silk-rose-pomander-kissing-ball-8-5-coral-141.jpgwild-page1https://s.yimg.com/aah/shopwildthings/flower-ball-silk-rose-pomander-kissing-ball-8-5-pink-187.jpghttps://s.yimg.com/aah/shopwildthings/flower-ball-silk-rose-pomander-kissing-ball-8-5-pink-188.jpgwild-page1https://s.yimg.com/aah/shopwildthings/flower-ball-silk-rose-pomander-kissing-ball-8-5-purple-252.jpghttps://s.yimg.com/aah/shopwildthings/flower-ball-silk-rose-pomander-kissing-ball-8-5-purple-253.jpgwild-pagelimegreendecor1https://s.yimg.com/aah/shopwildthings/flower-ball-silk-rose-pomander-kissing-ball-8-5-apple-green-115.jpghttps://s.yimg.com/aah/shopwildthings/flower-ball-silk-rose-pomander-kissing-ball-8-5-apple-green-116.jpgOur Kissing Pomander Balls come in a huge variety of colors and are covered in high quality silk roses and are ready to be a key decorating element in your upcoming special day! Hang Pomanders from Shepherd's Hooks, from Manzanita Centerpiece Trees, or from Branches and Sprays in your floral Decor. Top a Vase with a Rose Ball and hang strands of our Crystals from them. Use the attached matching Satin Ribbon to hang them up if you'd like, or remove it and add a strand of pearls (we sell inexpensive Rolls of Pearls!) to hang them from. We think you could also really "fancy them up" by adding a short portion of Crystal Garland and attaching a Crystal Pendant to the bottom. If you'd like our help with this, just give us a call! We offer our Flower Pomander Kissing Balls in 4 1/2", 6", 8 1/2" and 10 1/2" diameters. Try mixing the sizes and colors! The Roses are gloriously beautiful, and full and about 4" wide. We shopped and shopped trying to find Rose Balls that looked like real roses, didn't look cheap, but did not have the price tag of fresh flowers. We feel that this style will meet the needs of discerning buyers without a cost that will break the bank.shepherdshooks rollsofbeads peacgl gaandstwild-pagelimegreendecor1https://s.yimg.com/aah/shopwildthings/flower-ball-silk-rose-pomander-kissing-ball-8-5-aqua-128.jpghttps://s.yimg.com/aah/shopwildthings/flower-ball-silk-rose-pomander-kissing-ball-8-5-aqua-129.jpgOur Kissing Pomander Balls come in a huge variety of colors and are covered in high quality silk roses and are ready to be a key decorating element in your upcoming special day! Hang Pomanders from Shepherd's Hooks, from Manzanita Centerpiece Trees, or from Branches and Sprays in your floral Decor. Top a Vase with a Rose Ball and hang strands of our Crystals from them. Use the attached matching Satin Ribbon to hang them up if you'd like, or remove it and add a strand of pearls (we sell inexpensive Rolls of Pearls!) to hang them from. We think you could also really "fancy them up" by adding a short portion of Crystal Garland and attaching a Crystal Pendant to the bottom. If you'd like our help with this, just give us a call! We offer our Flower Pomander Kissing Balls in 4 1/2", 6", 8 1/2" and 10 1/2" diameters. Try mixing the sizes and colors! The Roses are gloriously beautiful, and full and about 4" wide. We shopped and shopped trying to find Rose Balls that looked like real roses, didn't look cheap, but did not have the price tag of fresh flowers. We feel that this style will meet the needs of discerning buyers without a cost that will break the bank.shepherdshooks rollsofbeads peacgl gaandstwild-pageblackdecor1https://s.yimg.com/aah/shopwildthings/flower-ball-silk-rose-pomander-kissing-ball-8-5-black-186.jpghttps://s.yimg.com/aah/shopwildthings/flower-ball-silk-rose-pomander-kissing-ball-8-5-black-187.jpgOur Kissing Pomander Balls come in a huge variety of colors and are covered in high quality silk roses and are ready to be a key decorating element in your upcoming special day! Hang Pomanders from Shepherd's Hooks, from Manzanita Centerpiece Trees, or from Branches and Sprays in your floral Decor. Top a Vase with a Rose Ball and hang strands of our Crystals from them. Use the attached matching Satin Ribbon to hang them up if you'd like, or remove it and add a strand of pearls (we sell inexpensive Rolls of Pearls!) to hang them from. We think you could also really "fancy them up" by adding a short portion of Crystal Garland and attaching a Crystal Pendant to the bottom. If you'd like our help with this, just give us a call! We offer our Flower Pomander Kissing Balls in 4 1/2", 6", 8 1/2" and 10 1/2" diameters. Try mixing the sizes and colors! The Roses are gloriously beautiful, and full and about 4" wide. We shopped and shopped trying to find Rose Balls that looked like real roses, didn't look cheap, but did not have the price tag of fresh flowers. We feel that this style will meet the needs of discerning buyers without a cost that will break the bank.shepherdshooks rollsofbeads peacgl gaandstwild-pagebltude1https://s.yimg.com/aah/shopwildthings/flower-ball-silk-rose-pomander-kissing-ball-85-blue-96.jpghttps://s.yimg.com/aah/shopwildthings/flower-ball-silk-rose-pomander-kissing-ball-85-blue-97.jpgOur Kissing Pomander Balls come in a huge variety of colors and are covered in high quality silk roses and are ready to be a key decorating element in your upcoming special day! Hang Pomanders from Shepherd's Hooks, from Manzanita Centerpiece Trees, or from Branches and Sprays in your floral Decor. Top a Vase with a Rose Ball and hang strands of our Crystals from them. Use the attached matching Satin Ribbon to hang them up if you'd like, or remove it and add a strand of pearls (we sell inexpensive Rolls of Pearls!) to hang them from. We think you could also really "fancy them up" by adding a short portion of Crystal Garland and attaching a Crystal Pendant to the bottom. If you'd like our help with this, just give us a call! We offer our Flower Pomander Kissing Balls in 4 1/2", 6", 8 1/2" and 10 1/2" diameters. Try mixing the sizes and colors! The Roses are gloriously beautiful, and full and about 4" wide. We shopped and shopped trying to find Rose Balls that looked like real roses, didn't look cheap, but did not have the price tag of fresh flowers. We feel that this style will meet the needs of discerning buyers without a cost that will break the bank.shepherdshooks rollsofbeads peacgl gaandstwild-pagebrowndecor1https://s.yimg.com/aah/shopwildthings/flower-ball-silk-rose-pomander-kissing-ball-8-5-brown-125.jpghttps://s.yimg.com/aah/shopwildthings/flower-ball-silk-rose-pomander-kissing-ball-8-5-brown-126.jpgOur Kissing Pomander Balls come in a huge variety of colors and are covered in high quality silk roses and are ready to be a key decorating element in your upcoming special day! Hang Pomanders from Shepherd's Hooks, from Manzanita Centerpiece Trees, or from Branches and Sprays in your floral Decor. Top a Vase with a Rose Ball and hang strands of our Crystals from them. Use the attached matching Satin Ribbon to hang them up if you'd like, or remove it and add a strand of pearls (we sell inexpensive Rolls of Pearls!) to hang them from. We think you could also really "fancy them up" by adding a short portion of Crystal Garland and attaching a Crystal Pendant to the bottom. If you'd like our help with this, just give us a call! We offer our Flower Pomander Kissing Balls in 4 1/2", 6", 8 1/2" and 10 1/2" diameters. Try mixing the sizes and colors! The Roses are gloriously beautiful, and full and about 4" wide. We shopped and shopped trying to find Rose Balls that looked like real roses, didn't look cheap, but did not have the price tag of fresh flowers. We feel that this style will meet the needs of discerning buyers without a cost that will break the bank.shepherdshooks rollsofbeads peacgl gaandstwild-pagepinks1https://s.yimg.com/aah/shopwildthings/flower-ball-silk-rose-pomander-kissing-ball-8-5-coral-142.jpghttps://s.yimg.com/aah/shopwildthings/flower-ball-silk-rose-pomander-kissing-ball-8-5-coral-143.jpgOur Kissing Pomander Balls come in a huge variety of colors and are covered in high quality silk roses and are ready to be a key decorating element in your upcoming special day! Hang Pomanders from Shepherd's Hooks, from Manzanita Centerpiece Trees, or from Branches and Sprays in your floral Decor. Top a Vase with a Rose Ball and hang strands of our Crystals from them. Use the attached matching Satin Ribbon to hang them up if you'd like, or remove it and add a strand of pearls (we sell inexpensive Rolls of Pearls!) to hang them from. We think you could also really "fancy them up" by adding a short portion of Crystal Garland and attaching a Crystal Pendant to the bottom. If you'd like our help with this, just give us a call! We offer our Flower Pomander Kissing Balls in 4 1/2", 6", 8 1/2" and 10 1/2" diameters. Try mixing the sizes and colors! The Roses are gloriously beautiful, and full and about 4" wide. We shopped and shopped trying to find Rose Balls that looked like real roses, didn't look cheap, but did not have the price tag of fresh flowers. We feel that this style will meet the needs of discerning buyers without a cost that will break the bank.shepherdshooks rollsofbeads peacgl gaandstwild-pagereddecor1https://s.yimg.com/aah/shopwildthings/flower-ball-silk-rose-pomander-kissing-ball-8-5-fuchsia-149.jpghttps://s.yimg.com/aah/shopwildthings/flower-ball-silk-rose-pomander-kissing-ball-8-5-fuchsia-150.jpgOur Kissing Pomander Balls come in a huge variety of colors and are covered in high quality silk roses and are ready to be a key decorating element in your upcoming special day! Hang Pomanders from Shepherd's Hooks, from Manzanita Centerpiece Trees, or from Branches and Sprays in your floral Decor. Top a Vase with a Rose Ball and hang strands of our Crystals from them. Use the attached matching Satin Ribbon to hang them up if you'd like, or remove it and add a strand of pearls (we sell inexpensive Rolls of Pearls!) to hang them from. We think you could also really "fancy them up" by adding a short portion of Crystal Garland and attaching a Crystal Pendant to the bottom. If you'd like our help with this, just give us a call! We offer our Flower Pomander Kissing Balls in 4 1/2", 6", 8 1/2" and 10 1/2" diameters. Try mixing the sizes and colors! The Roses are gloriously beautiful, and full and about 4" wide. We shopped and shopped trying to find Rose Balls that looked like real roses, didn't look cheap, but did not have the price tag of fresh flowers. We feel that this style will meet the needs of discerning buyers without a cost that will break the bank.shepherdshooks rollsofbeads peacgl gaandstwild-pagegolddecor1https://s.yimg.com/aah/shopwildthings/flower-ball-silk-rose-pomander-kissing-ball-8-5-gold-58.jpghttps://s.yimg.com/aah/shopwildthings/flower-ball-silk-rose-pomander-kissing-ball-8-5-gold-59.jpgOur Kissing Pomander Balls come in a huge variety of colors and are covered in high quality silk roses and are ready to be a key decorating element in your upcoming special day! Hang Pomanders from Shepherd's Hooks, from Manzanita Centerpiece Trees, or from Branches and Sprays in your floral Decor. Top a Vase with a Rose Ball and hang strands of our Crystals from them. Use the attached matching Satin Ribbon to hang them up if you'd like, or remove it and add a strand of pearls (we sell inexpensive Rolls of Pearls!) to hang them from. We think you could also really "fancy them up" by adding a short portion of Crystal Garland and attaching a Crystal Pendant to the bottom. If you'd like our help with this, just give us a call! We offer our Flower Pomander Kissing Balls in 4 1/2", 6", 8 1/2" and 10 1/2" diameters. Try mixing the sizes and colors! The Roses are gloriously beautiful, and full and about 4" wide. We shopped and shopped trying to find Rose Balls that looked like real roses, didn't look cheap, but did not have the price tag of fresh flowers. We feel that this style will meet the needs of discerning buyers without a cost that will break the bank.ropokiba shepherdshooks rollsofbeads peacgl gaandstwild-pagelimegreendecor1https://s.yimg.com/aah/shopwildthings/flower-ball-silk-rose-pomander-kissing-ball-8-5-ivory-161.jpghttps://s.yimg.com/aah/shopwildthings/flower-ball-silk-rose-pomander-kissing-ball-8-5-ivory-162.jpgOur Kissing Pomander Balls come in a huge variety of colors and are covered in high quality silk roses and are ready to be a key decorating element in your upcoming special day! Hang Pomanders from Shepherd's Hooks, from Manzanita Centerpiece Trees, or from Branches and Sprays in your floral Decor. Top a Vase with a Rose Ball and hang strands of our Crystals from them. Use the attached matching Satin Ribbon to hang them up if you'd like, or remove it and add a strand of pearls (we sell inexpensive Rolls of Pearls!) to hang them from. We think you could also really "fancy them up" by adding a short portion of Crystal Garland and attaching a Crystal Pendant to the bottom. If you'd like our help with this, just give us a call! We offer our Flower Pomander Kissing Balls in 4 1/2", 6", 8 1/2" and 10 1/2" diameters. Try mixing the sizes and colors! The Roses are gloriously beautiful, and full and about 4" wide. We shopped and shopped trying to find Rose Balls that looked like real roses, didn't look cheap, but did not have the price tag of fresh flowers. We feel that this style will meet the needs of discerning buyers without a cost that will break the bank.shepherdshooks rollsofbeads peacgl gaandstwild-pageropokiba1https://s.yimg.com/aah/shopwildthings/flower-ball-silk-rose-pomander-kissing-ball-8-5-orange-62.jpghttps://s.yimg.com/aah/shopwildthings/flower-ball-silk-rose-pomander-kissing-ball-8-5-orange-63.jpgOur Kissing Pomander Balls come in a huge variety of colors and are covered in high quality silk roses and are ready to be a key decorating element in your upcoming special day! Hang Pomanders from Shepherd's Hooks, from Manzanita Centerpiece Trees, or from Branches and Sprays in your floral Decor. Top a Vase with a Rose Ball and hang strands of our Crystals from them. Use the attached matching Satin Ribbon to hang them up if you'd like, or remove it and add a strand of pearls (we sell inexpensive Rolls of Pearls!) to hang them from. We think you could also really "fancy them up" by adding a short portion of Crystal Garland and attaching a Crystal Pendant to the bottom. If you'd like our help with this, just give us a call! We offer our Flower Pomander Kissing Balls in 4 1/2", 6", 8 1/2" and 10 1/2" diameters. Try mixing the sizes and colors! The Roses are gloriously beautiful, and full and about 4" wide. We shopped and shopped trying to find Rose Balls that looked like real roses, didn't look cheap, but did not have the price tag of fresh flowers. We feel that this style will meet the needs of discerning buyers without a cost that will break the bank.shepherdshooks rollsofbeads peacgl gaandstwild-pagereddecor1https://s.yimg.com/aah/shopwildthings/flower-ball-silk-rose-pomander-kissing-ball-8-5-pink-189.jpghttps://s.yimg.com/aah/shopwildthings/flower-ball-silk-rose-pomander-kissing-ball-8-5-pink-190.jpgOur Kissing Pomander Balls come in a huge variety of colors and are covered in high quality silk roses and are ready to be a key decorating element in your upcoming special day! Hang Pomanders from Shepherd's Hooks, from Manzanita Centerpiece Trees, or from Branches and Sprays in your floral Decor. Top a Vase with a Rose Ball and hang strands of our Crystals from them. Use the attached matching Satin Ribbon to hang them up if you'd like, or remove it and add a strand of pearls (we sell inexpensive Rolls of Pearls!) to hang them from. We think you could also really "fancy them up" by adding a short portion of Crystal Garland and attaching a Crystal Pendant to the bottom. If you'd like our help with this, just give us a call! We offer our Flower Pomander Kissing Balls in 4 1/2", 6", 8 1/2" and 10 1/2" diameters. Try mixing the sizes and colors! The Roses are gloriously beautiful, and full and about 4" wide. We shopped and shopped trying to find Rose Balls that looked like real roses, didn't look cheap, but did not have the price tag of fresh flowers. We feel that this style will meet the needs of discerning buyers without a cost that will break the bank.shepherdshooks rollsofbeads peacgl gaandstwild-pageropokiba1https://s.yimg.com/aah/shopwildthings/flower-ball-silk-rose-pomander-kissing-ball-8-5-purple-254.jpghttps://s.yimg.com/aah/shopwildthings/flower-ball-silk-rose-pomander-kissing-ball-8-5-purple-255.jpgOur Kissing Pomander Balls come in a huge variety of colors and are covered in high quality silk roses and are ready to be a key decorating element in your upcoming special day! Hang Pomanders from Shepherd's Hooks, from Manzanita Centerpiece Trees, or from Branches and Sprays in your floral Decor. Top a Vase with a Rose Ball and hang strands of our Crystals from them. Use the attached matching Satin Ribbon to hang them up if you'd like, or remove it and add a strand of pearls (we sell inexpensive Rolls of Pearls!) to hang them from. We think you could also really "fancy them up" by adding a short portion of Crystal Garland and attaching a Crystal Pendant to the bottom. If you'd like our help with this, just give us a call! We offer our Flower Pomander Kissing Balls in 4 1/2", 6", 8 1/2" and 10 1/2" diameters. Try mixing the sizes and colors! The Roses are gloriously beautiful, and full and about 4" wide. We shopped and shopped trying to find Rose Balls that looked like real roses, didn't look cheap, but did not have the price tag of fresh flowers. We feel that this style will meet the needs of discerning buyers without a cost that will break the bank.shepherdshooks rollsofbeads peacgl gaandstwild-pagereddecor1https://s.yimg.com/aah/shopwildthings/flower-ball-silk-rose-pomander-kissing-ball-8-5-red-259.jpghttps://s.yimg.com/aah/shopwildthings/flower-ball-silk-rose-pomander-kissing-ball-8-5-red-260.jpgOur Kissing Pomander Balls come in a huge variety of colors and are covered in high quality silk roses and are ready to be a key decorating element in your upcoming special day! Hang Pomanders from Shepherd's Hooks, from Manzanita Centerpiece Trees, or from Branches and Sprays in your floral Decor. Top a Vase with a Rose Ball and hang strands of our Crystals from them. Use the attached matching Satin Ribbon to hang them up if you'd like, or remove it and add a strand of pearls (we sell inexpensive Rolls of Pearls!) to hang them from. We think you could also really "fancy them up" by adding a short portion of Crystal Garland and attaching a Crystal Pendant to the bottom. If you'd like our help with this, just give us a call! We offer our Flower Pomander Kissing Balls in 4 1/2", 6", 8 1/2" and 10 1/2" diameters. Try mixing the sizes and colors! The Roses are gloriously beautiful, and full and about 4" wide. We shopped and shopped trying to find Rose Balls that looked like real roses, didn't look cheap, but did not have the price tag of fresh flowers. We feel that this style will meet the needs of discerning buyers without a cost that will break the bank.shepherdshooks rollsofbeads peacgl gaandstwild-pagebltude1https://s.yimg.com/aah/shopwildthings/flower-ball-silk-rose-pomander-kissing-ball-8-5-royal-blue-185.jpghttps://s.yimg.com/aah/shopwildthings/flower-ball-silk-rose-pomander-kissing-ball-8-5-royal-blue-186.jpgOur Kissing Pomander Balls come in a huge variety of colors and are covered in high quality silk roses and are ready to be a key decorating element in your upcoming special day! Hang Pomanders from Shepherd's Hooks, from Manzanita Centerpiece Trees, or from Branches and Sprays in your floral Decor. Top a Vase with a Rose Ball and hang strands of our Crystals from them. Use the attached matching Satin Ribbon to hang them up if you'd like, or remove it and add a strand of pearls (we sell inexpensive Rolls of Pearls!) to hang them from. We think you could also really "fancy them up" by adding a short portion of Crystal Garland and attaching a Crystal Pendant to the bottom. If you'd like our help with this, just give us a call! We offer our Flower Pomander Kissing Balls in 4 1/2", 6", 8 1/2" and 10 1/2" diameters. Try mixing the sizes and colors! The Roses are gloriously beautiful, and full and about 4" wide. We shopped and shopped trying to find Rose Balls that looked like real roses, didn't look cheap, but did not have the price tag of fresh flowers. We feel that this style will meet the needs of discerning buyers without a cost that will break the bank.shepherdshooks rollsofbeads peacgl gaandstwild-pagesilverdecor1https://s.yimg.com/aah/shopwildthings/flower-ball-silk-rose-pomander-kissing-ball-8-5-silver-58.jpghttps://s.yimg.com/aah/shopwildthings/flower-ball-silk-rose-pomander-kissing-ball-8-5-silver-59.jpgOur Kissing Pomander Balls come in a huge variety of colors and are covered in high quality silk roses and are ready to be a key decorating element in your upcoming special day! Hang Pomanders from Shepherd's Hooks, from Manzanita Centerpiece Trees, or from Branches and Sprays in your floral Decor. Top a Vase with a Rose Ball and hang strands of our Crystals from them. Use the attached matching Satin Ribbon to hang them up if you'd like, or remove it and add a strand of pearls (we sell inexpensive Rolls of Pearls!) to hang them from. We think you could also really "fancy them up" by adding a short portion of Crystal Garland and attaching a Crystal Pendant to the bottom. If you'd like our help with this, just give us a call! We offer our Flower Pomander Kissing Balls in 4 1/2", 6", 8 1/2" and 10 1/2" diameters. Try mixing the sizes and colors! The Roses are gloriously beautiful, and full and about 4" wide. We shopped and shopped trying to find Rose Balls that looked like real roses, didn't look cheap, but did not have the price tag of fresh flowers. We feel that this style will meet the needs of discerning buyers without a cost that will break the bank.ropokiba shepherdshooks rollsofbeads peacgl gaandstwild-pagebltude1https://s.yimg.com/aah/shopwildthings/flower-ball-silk-rose-pomander-kissing-ball-8-5-turquoise-138.jpghttps://s.yimg.com/aah/shopwildthings/flower-ball-silk-rose-pomander-kissing-ball-8-5-turquoise-139.jpgOur Kissing Pomander Balls come in a huge variety of colors and are covered in high quality silk roses and are ready to be a key decorating element in your upcoming special day! Hang Pomanders from Shepherd's Hooks, from Manzanita Centerpiece Trees, or from Branches and Sprays in your floral Decor. Top a Vase with a Rose Ball and hang strands of our Crystals from them. Use the attached matching Satin Ribbon to hang them up if you'd like, or remove it and add a strand of pearls (we sell inexpensive Rolls of Pearls!) to hang them from. We think you could also really "fancy them up" by adding a short portion of Crystal Garland and attaching a Crystal Pendant to the bottom. If you'd like our help with this, just give us a call! We offer our Flower Pomander Kissing Balls in 4 1/2", 6", 8 1/2" and 10 1/2" diameters. Try mixing the sizes and colors! The Roses are gloriously beautiful, and full and about 4" wide. We shopped and shopped trying to find Rose Balls that looked like real roses, didn't look cheap, but did not have the price tag of fresh flowers. We feel that this style will meet the needs of discerning buyers without a cost that will break the bank.shepherdshooks rollsofbeads peacgl gaandstwild-pagelimegreendecor1https://s.yimg.com/aah/shopwildthings/flower-ball-silk-rose-pomander-kissing-ball-8-5-white-189.jpghttps://s.yimg.com/aah/shopwildthings/flower-ball-silk-rose-pomander-kissing-ball-8-5-white-190.jpgOur Kissing Pomander Balls come in a huge variety of colors and are covered in high quality silk roses and are ready to be a key decorating element in your upcoming special day! Hang Pomanders from Shepherd's Hooks, from Manzanita Centerpiece Trees, or from Branches and Sprays in your floral Decor. Top a Vase with a Rose Ball and hang strands of our Crystals from them. Use the attached matching Satin Ribbon to hang them up if you'd like, or remove it and add a strand of pearls (we sell inexpensive Rolls of Pearls!) to hang them from. We think you could also really "fancy them up" by adding a short portion of Crystal Garland and attaching a Crystal Pendant to the bottom. If you'd like our help with this, just give us a call! We offer our Flower Pomander Kissing Balls in 4 1/2", 6", 8 1/2" and 10 1/2" diameters. Try mixing the sizes and colors! The Roses are gloriously beautiful, and full and about 4" wide. We shopped and shopped trying to find Rose Balls that looked like real roses, didn't look cheap, but did not have the price tag of fresh flowers. We feel that this style will meet the needs of discerning buyers without a cost that will break the bank.shepherdshooks rollsofbeads peacgl gaandstwild-pageyellowdecor1https://s.yimg.com/aah/shopwildthings/flower-ball-silk-rose-pomander-kissing-ball-8-5-yellow-126.jpghttps://s.yimg.com/aah/shopwildthings/flower-ball-silk-rose-pomander-kissing-ball-8-5-yellow-127.jpgOur Kissing Pomander Balls come in a huge variety of colors and are covered in high quality silk roses and are ready to be a key decorating element in your upcoming special day! Hang Pomanders from Shepherd's Hooks, from Manzanita Centerpiece Trees, or from Branches and Sprays in your floral Decor. Top a Vase with a Rose Ball and hang strands of our Crystals from them. Use the attached matching Satin Ribbon to hang them up if you'd like, or remove it and add a strand of pearls (we sell inexpensive Rolls of Pearls!) to hang them from. We think you could also really "fancy them up" by adding a short portion of Crystal Garland and attaching a Crystal Pendant to the bottom. If you'd like our help with this, just give us a call! We offer our Flower Pomander Kissing Balls in 4 1/2", 6", 8 1/2" and 10 1/2" diameters. Try mixing the sizes and colors! The Roses are gloriously beautiful, and full and about 4" wide. We shopped and shopped trying to find Rose Balls that looked like real roses, didn't look cheap, but did not have the price tag of fresh flowers. We feel that this style will meet the needs of discerning buyers without a cost that will break the bank.shepherdshooks rollsofbeads peacgl gaandstwild-pagepinks1https://s.yimg.com/aah/shopwildthings/flower-ball-silk-rose-pomander-kissing-ball-6-1-2-dusty-pink-34.jpghttps://s.yimg.com/aah/shopwildthings/flower-ball-silk-rose-pomander-kissing-ball-6-1-2-dusty-pink-35.jpgWedding Arch. These also look spectacular hanging from Manzanita Centerpiece Trees, from Branches and Sprays or when used on a flower wall backdrop. Top a Centerpiece Vase with a Rose Ball for a simple yet very elegant accent piece. These floral balls are so easy to work with and if you'd like to make them a bit more ritzy, use Pearl or Crystal Garland Strands to hang the balls or insert some strands into the Styrofoam for added glamour. For flower girls and the bridal party, it doesn't get much easier than using these quality flower balls and they become a favorite memento for years to come! The hard Styrofoam center securely holds the flowers so you don't have to worry like you do with real, fragile flowers. We offer our Flower Pomander Kissing Balls in many sizes, colors and styles so you're sure to find the perfect flowers to fit your occasion! The Roses are gloriously beautiful and full! We shopped and shopped trying to find Rose Balls that looked like real roses, didn't look cheap, but did not have the price tag of fresh flowers. We feel that this style will meet the needs of discerning buyers without a cost that will break the bank!]]>ropokiba silkflowers shepherdshooks vaflvaeitocywild-pagepurplestuff1https://s.yimg.com/aah/shopwildthings/flower-ball-silk-rose-pomander-kissing-ball-6-1-2-lavender-41.jpghttps://s.yimg.com/aah/shopwildthings/flower-ball-silk-rose-pomander-kissing-ball-6-1-2-lavender-42.jpgWedding Arch. These also look spectacular hanging from Manzanita Centerpiece Trees, from Branches and Sprays or when used on a flower wall backdrop. Top a Centerpiece Vase with a Rose Ball for a simple yet very elegant accent piece. These floral balls are so easy to work with and if you'd like to make them a bit more ritzy, use Pearl or Crystal Garland Strands to hang the balls or insert some strands into the Styrofoam for added glamour. For flower girls and the bridal party, it doesn't get much easier than using these quality flower balls and they become a favorite memento for years to come! The hard Styrofoam center securely holds the flowers so you don't have to worry like you do with real, fragile flowers. We offer our Flower Pomander Kissing Balls in many sizes, colors and styles so you're sure to find the perfect flowers to fit your occasion! The Roses are gloriously beautiful and full! We shopped and shopped trying to find Rose Balls that looked like real roses, didn't look cheap, but did not have the price tag of fresh flowers. We feel that this style will meet the needs of discerning buyers without a cost that will break the bank!]]>ropokiba silkflowers shepherdshooks vaflvaeitocywild-pagepurplestuff1https://s.yimg.com/aah/shopwildthings/flower-ball-silk-rose-pomander-kissing-ball-9-1-2-lavender-41.jpghttps://s.yimg.com/aah/shopwildthings/flower-ball-silk-rose-pomander-kissing-ball-9-1-2-lavender-42.jpgWedding Arch. These also look spectacular hanging from Manzanita Centerpiece Trees, from Branches and Sprays or when used on a flower wall backdrop. Top a Centerpiece Vase with a Rose Ball for a simple yet very elegant accent piece. These floral balls are so easy to work with and if you'd like to make them a bit more ritzy, use Pearl or Crystal Garland Strands to hang the balls or insert some strands into the Styrofoam for added glamour. For flower girls and the bridal party, it doesn't get much easier than using these quality flower balls and they become a favorite memento for years to come! The hard Styrofoam center securely holds the flowers so you don't have to worry like you do with real, fragile flowers. We offer our Flower Pomander Kissing Balls in many sizes, colors and styles so you're sure to find the perfect flowers to fit your occasion! The Roses are gloriously beautiful and full! We shopped and shopped trying to find Rose Balls that looked like real roses, didn't look cheap, but did not have the price tag of fresh flowers. We feel that this style will meet the needs of discerning buyers without a cost that will break the bank!]]>ropokiba vaflvaeitocy silkflowerswild-pagewhclde1https://s.yimg.com/aah/shopwildthings/flower-ball-10-premium-silk-roses-peonies-hydrangeas-pure-white-32.jpghttps://s.yimg.com/aah/shopwildthings/flower-ball-10-premium-silk-roses-peonies-hydrangeas-pure-white-33.jpgWith this 1 flower ball, you really get 2 toppers for vases or risers! In the main photo, the upper left shows the whole flower ball, the upper rights shows the ball split into 2 halves and the bottom center shows half of the ball sitting on a vase. So very elegant and so very full, our Pure White Flower Ball is 9 3/4" in diameter and bursting with lovely silk flowers that are huge and luscious! Each ball splits into 2 halves so you can use this Pomander Kissing Ball in a variety of ways. There are 14 huge blooms consisting of 7 roses that measure 4" wide by 3" tall and 7 peonies that measure 3 1/2" wide by 3" tall! The remainder of the ball is filled with 2 1/2" wide hydrangeas and the variety and size of flowers makes this ball visually and texturally outstanding! There are green silk leaves popping from the base of the flowers and with a little fluffing, you cannot see the plastic grid frame at all. This is one grandiose item that splits into 2 superior products! For weddings and events, these are ideal for hanging off of pews or for flower girls to carry and they make a treasured, lasting memento! The plastic grid framework makes it easy to attach a ribbon or if you'd like to make them a bit more ritzy, attach White Pearl or Sparkling Crystal Garland Strands. For maximum impact centerpiece Decor, place an entire ball atop a Crystal Beaded Trumpet Vase or split the ball into 2 halves to gain twice the decorating capacity. There are pegs and holes on the frame so you can split and reconnect the halves as much as needed. Each half sphere can sit on a Centerpiece Riser, elevated cake stand or use to outline the cake table or make a floral, serpentine table runner. These half balls can also be attached to flower walls or stapled to actual walls. For outdoor ceremonies, hang from trees, tents and arches or create a romantic aisle walkway by hanging them from shepherds' hooks. These floral accent balls are so easy to work with and give a huge visual impact. We offer our Flower Pomander Kissing Balls in many sizes, colors and styles so you're sure to find the perfect flowers to fit your occasion! We shopped and shopped trying to find quality flower balls that are jam-packed with blooms that look like real flowers, without the expense of fresh flowers. We feel that the superiority and style of these decorative accent pieces will meet the needs of discerning buyers with a cost that won't break the bank!]]>vaflvaeitocy catrfatr floral-walls-greenery-backdropswild-pagesilkflowers1https://s.yimg.com/aah/shopwildthings/blue-hydrangea-flower-balls-48.jpghttps://s.yimg.com/aah/shopwildthings/blue-hydrangea-flower-balls-49.jpgShepherds' Hooks to line an aisle, hang from a ceremony arch, gazeebo or even trees. The ribbon loops make this ideal to slide onto pipe and drape kits or use Hanging Hooks to hang from any structure like an overhead trellis. No hardware to hang this garland from? No problem! This lightweight garland can simply be stapled or tacked to a wall in a design of your choice to provide a backdrop for the head table! This also makes an excellent table runner centerpiece for a garden party or drape it on the front of a table to add color and glamour!]]>ropokiba floral-walls-greenery-backdrops silk-flower-garlandswild-pagesilkflowers1https://s.yimg.com/aah/shopwildthings/ivory-hydrangea-flower-balls-wedding-decor-41.jpghttps://s.yimg.com/aah/shopwildthings/ivory-hydrangea-flower-balls-wedding-decor-42.jpgShepherds' Hooks to line an aisle, hang from a ceremony arch, gazeebo or even trees. The ribbon loops make this ideal to slide onto pipe and drape kits or use Hanging Hooks to hang from any structure like an overhead trellis. No hardware to hang this garland from? No problem! This lightweight garland can simply be stapled or tacked to a wall in a design of your choice to provide a backdrop for the head table! This also makes an excellent table runner centerpiece for a garden party or drape it on the front of a table to add texture and glamour!]]>ropokiba floral-walls-greenery-backdrops silk-flower-garlandswild-pagesilkflowers1https://s.yimg.com/aah/shopwildthings/pink-hydrangea-flower-garland-ball-41.jpghttps://s.yimg.com/aah/shopwildthings/pink-hydrangea-flower-garland-ball-42.jpgShepherds' Hooks to line an aisle, hang from a ceremony arch, gazeebo or even trees. The ribbon loops make this ideal to slide onto pipe and drape kits or use Hanging Hooks to hang from any structure like an overhead trellis. No hardware to hang this garland from? No problem! This lightweight garland can simply be stapled or tacked to a wall in a design of your choice to provide a backdrop for the head table! This also makes an excellent table runner centerpiece for a garden party or drape it on the front of a table to add color and glamour!]]>ropokiba floral-walls-greenery-backdrops silk-flower-garlandswild-pagelimegreendecor11https://s.yimg.com/aah/shopwildthings/flower-bouquet-holders-floral-foam-set-of-6-each-3-x-7-30.jpghttps://s.yimg.com/aah/shopwildthings/flower-bouquet-holders-floral-foam-set-of-6-each-3-x-7-31.jpgSilk Ivory Rose Spray which has 7 heads. Snip off each stem at the desired length and poke into the foam. A dab of hot glue on the end of the stem gives additional security. Add height with orchids and eucalyptus sprays or create a cascading effect with draping blooms like wisteria and Amaranthus. Baby's Breath is an excellent filler as are the blooms of our flowering tree branches and snips of small leafy green sprays brings the bouquet all together. Our faux florals not only offer you top quality silk selections, but the array of colors and varying textures provide you with a large range of choices. Other materials you can add are tulle, feathers and snips of curly glitter sprays. For materials that don't have a stiff stem, like our delicate and beautiful White Pearl Beaded Garland, simply secure them to the plastic cage surrounding the foam head. At the base of the foam head, add greenery like pieces of a Silk Grape Leaf Vine to complete the look. These holders are also ideal for creating pew decorations and for decorating wedding arches. There are countless styles of bouquets and you deserve to see your vision come true. Be inspired by your own creativity and you can't fail. ]]>acprso silkflowers artificialgreenery succulents-for-events gaandst brandspwild-pagebrandnewitems1https://s.yimg.com/aah/shopwildthings/clear-glass-bottles-on-colorful-plates-4-colors-available-cutest-things-ever-90.jpghttps://s.yimg.com/aah/shopwildthings/clear-glass-bottles-on-colorful-plates-4-colors-available-cutest-things-ever-91.jpgSucculents. The vivid color on the plate is so peppy and along with this bright lime green, we also have fuchsia pink, purple and orange. Using the 4 together makes a very energetic and happy centerpiece! The bottles have a rim so you can tie thin ribbons for added color and another idea is to place delicate butterflies or Textured Diamond Confetti on the plate for added pop! ]]>vaflvaeitocy silkflowers succulents-for-eventswild-pageorangedecor1https://s.yimg.com/aah/shopwildthings/flower-cutting-holder-orange-plate-7-glass-bottles-34.jpghttps://s.yimg.com/aah/shopwildthings/flower-cutting-holder-orange-plate-7-glass-bottles-35.jpgSucculents. The vivid color on the plate is so peppy and along with this bright orange, we also have fuchsia pink, purple and lime green. Using the 4 together makes a very energetic and happy centerpiece! The bottles have a rim so you can tie thin ribbons for added color and another idea is to place delicate butterflies or Textured Diamond Confetti on the plate for added pop!]]>vaflvaeitocy silkflowers succulents-for-eventswild-pagepinks1https://s.yimg.com/aah/shopwildthings/flower-cutting-holder-pink-plate-7-glass-bottles-38.jpghttps://s.yimg.com/aah/shopwildthings/flower-cutting-holder-pink-plate-7-glass-bottles-39.jpgSucculents. The vivid color on the plate is so peppy and along with this bright fuchsia pink, we also have lime green, purple and orange. Using the 4 together makes a very energetic and happy centerpiece! The bottles have a rim so you can tie thin ribbons for added color and another idea is to place delicate butterflies or Textured Diamond Confetti on the plate for added pop!]]>vaflvaeitocy silkflowers succulents-for-eventswild-pagepurplestuff1https://s.yimg.com/aah/shopwildthings/flower-cutting-holder-purple-plate-7-glass-bottles-34.jpghttps://s.yimg.com/aah/shopwildthings/flower-cutting-holder-purple-plate-7-glass-bottles-35.jpgSucculents. The vivid color on the plate is so peppy and along with this bright purple, we also have fuchsia pink, lime green and orange. Using the 4 together makes a very energetic and happy centerpiece! The bottles have a rim so you can tie thin ribbons for added color and another idea is to place delicate butterflies or Textured Diamond Confetti on the plate for added pop!]]>vaflvaeitocy silkflowers succulents-for-eventswild-pagesilkflowers1https://s.yimg.com/aah/shopwildthings/flower-garland-extra-fancy-white-silk-plumeria-over-7-long-bendable-wire-71.jpghttps://s.yimg.com/aah/shopwildthings/flower-garland-extra-fancy-white-silk-plumeria-over-7-long-bendable-wire-72.jpgPlease note: the main photo shows several of the garlands hanging in one photo to give you a design idea. If you order one, you will get ONE fabulous garland that is 7 Feet Long. Order more than 1 to create the look of several garlands hanging. Our garlands have invisible wire inside, which is a HUGE deal. This means that you can position them how you want and they'll stay like that. This dreamy floral garland is so versatile and the lovely blooms give that romantic, enchanted feeling! The silky soft flowers are approx. 3" wide and the entire length of this garland is 92" which includes a 14" flexible plastic stem and wire that you can bend, wrap, join to another garland or use to attach it to Wedding Arches or Shepherds' Hooks, railings or use to suspend from ceiling hooks. You can join several together to outline a gift and cake table or lay down the center of a table, add some Flameless LED Candles or fairy string lights, maybe add some beaded crystal strands and there"s your centerpiece! The flexibility of this garland allows you to weave it around candles, form a wreath or create a circle of flowers. Whether your event is traditional, tropical, rustic or garden-themed, this ornamental Plumeria Flower Garland can easily be translated to stress-free decorating for your perfect day!]]>silkflowers brandsp garlands-and-pendants hangingcandle vaflvaeitocywild-pagesilkflowers1https://s.yimg.com/aah/shopwildthings/aqua-blue-flower-garlands-backdrops-parties-24.jpghttps://s.yimg.com/aah/shopwildthings/aqua-blue-flower-garlands-backdrops-parties-25.jpg
Create a dreamy flower filled rose extravaganza by pairing with our matching Silk Rose Pomander Kissing Balls that are available in several sizes!]]>
gaandst ropokiba wearisma tace
Create a dreamy flower filled rose extravaganza by pairing with our matching Silk Rose Pomander Kissing Balls that are available in several sizes!]]>
gaandst ropokiba wearisma tace
Create a dreamy flower filled rose extravaganza by pairing with our matching Silk Rose Pomander Kissing Balls that are available in several sizes or our Pink Rose and Plumeria Flower Wall!]]>
gaandst ropokiba brandsp wearisma tace
Create a dreamy flower filled rose extravaganza by pairing with our matching Silk Rose Pomander Kissing Balls that are available in several sizes!]]>
gaandst ropokiba wearisma tace
Create a dreamy flower filled rose extravaganza by pairing with our matching Silk Rose Pomander Kissing Balls that are available in several sizes!]]>
gaandst ropokiba wearisma tace
Create a dreamy flower filled rose extravaganza by pairing with our matching Silk Rose Pomander Kissing Balls that are available in several sizes!]]>
gaandst ropokiba wearisma tace
Create a dreamy flower filled rose extravaganza by pairing with our matching Silk Rose Pomander Kissing Balls that are available in several sizes!]]>
gaandst ropokiba wearisma tace
Create a dreamy flower filled rose extravaganza by pairing with our matching Silk Rose Pomander Kissing Balls that are available in several sizes!]]>
gaandst ropokiba wearisma tace
wild-pagesilkflowers1https://s.yimg.com/aah/shopwildthings/flower-garland-with-pearls-flex-handle-malana-white-30-98.jpghttps://s.yimg.com/aah/shopwildthings/flower-garland-with-pearls-flex-handle-malana-white-30-99.jpgLittle Dainty Flowers with a bendable cluster on top - perfect for floral centerpieces or to add to your bouquet! Every little detail counts when planning your special day and we get just how important it is to have every element look amazing, perform beautifully and last throughout the day. From hanging ceiling decor to table centerpieces and large floor vases, our aim is to provide you with superior products that save you decorating time while being sophisticated and glamorous. The main photo shows FOUR of these items hanging right next to each other. If you order 1 piece, you will get 1 of these garland that each has it's own hanging bouquet at the top and 6 strands of flowers hanging from it. Start with details like our charming Hanging Flower Garland "Malana" which means calming, relaxing and light - the perfect description for this soft and delicate garland that enhances wedding decor and adds elegance wherever it's used. Malana is 30" long with an additional 3" flexible hanging loop. At the top of this garland is a 4" bouquet of flowers encircled by a sheer, silvery bow. Streaming down from the bouquet are 6 strands of snow white flowers with faux pearl centers and at the end of each strand is a crystal clear faceted bead. The strands vary from 21" to 26" long and are attached with flexible wire so you can somewhat spread them out and the flowers are strung on clear monofilament line so they appear to be floating! Classy and graceful! The hanging loop is firm but bendable so you can round it out in a circle or condense it to an oval and you can position it straight up or completely horizontal. This versatile loop makes it very convenient to hang in a variety of areas. Use Malana to create spectacular ceiling decor by hanging from chandeliers or overhead structures. For instance, on a drop-ceiling, use magnetic hooks on the metal grids or hang from any horizontal line, wire, twine or rope and let the cascading strands create a romantic overhead flower garden. Hang from a balcony, trellis, pergola, pavilion, gazebo or party tents. As a centerpiece, place the loop around the base of a flameless LED candle and let the delicate flowers puddle onto a mirror. Use as aisle decor with shepherds' hooks, use as pew markers, hang on door knobs, hang from wedding arches, decorate a dessert table, incorporate into a bridal bouquet or adorn a flower girls basket. A breathtaking product to save you time while creating glamorous event decor!silkflowers budeitbugach hangingcandle gaandstwild-pagesilkflowers1https://s.yimg.com/aah/shopwildthings/flower-garland-with-bead-clusters-kaleen-white-70-97.jpghttps://s.yimg.com/aah/shopwildthings/flower-garland-with-bead-clusters-kaleen-white-70-98.jpgsilkflowers floral-walls-greenery-backdrops hangingcandle gaandstwild-pagetrees-and-floralflower-ball-ivory-8inch-silk-flowersivory-flower-ball-10inch-hanging-decorationhydrangea-silk-flower-ball-ivory-6inchesflower-rose-pomander-ivory-4inchesflower-ball-kissing-ball-ivory-roses-small-pomanderivory-roses-flower-ball-large-kissing-balls-pomanderivory-wedding-rose-flower-balls-10inchespremium-silk-flower-pomander-pure-cream-10inchespremium-silk-flower-pomander-pure-cream-14inchesfoam-petal-rose-ball-ivory-7inchesfoam-petal-rose-ball-ivory-8inchesfoam-petal-rose-ball-ivory-9inchesfoam-petal-rose-ball-ivory-12inchesfoam-petal-rose-ball-baby-ivory-13inchesivory-kissing-balls-wedding-centerpiece-garlandhydrangea-silk-flower-ball-white-6incheshydrangea-silk-flower-ball-white-10incheskissing-balls-weddings-white-silk-roses-4inchwedding-white-roses-flower-ball-kissing-balls-large-pomanderwhite-round-flower-ball-10inchespremium-silk-flower-pomander-pure-white-10inchesfoam-petal-rose-ball-white-7inchesfoam-petal-rose-ball-white-8inchesfoam-petal-rose-ball-white-10inchesfoam-petal-rose-ball-white-9inchesfoam-petal-rose-ball-white-12inchesfoam-petal-rose-ball-white-13inchesblush-pink-silk-hydrangea-ball-8inchpink-kissing-ball-8inch-silk-hydrangeasilk-flower-ball-10inch-pink-wedding-flowerspink-hydrangea-hanging-silk-flowerball-12inchhydrangea-silk-flower-ball-pink-6inchesround-hanging-flower-ball-pink-roses-small-pomanderpink-roses-round-flower-ball-large-8-5-inch-pomandercoral-8-5-inch-rose-ball-hanging-pomanderhydrangea-silk-flower-ball-coral-6incheshanging-flower-balls-silk-rose-coral-pomandersilk-kissing-ball-pink-roses-7inch-hangingpink-wedding-rose-ball-hanging-10inchfoam-petal-rose-ball-baby-pink-6inchesfoam-petal-rose-ball-baby-pink-10inchesfoam-petal-rose-ball-baby-pink-12inchesfoam-petal-rose-ball-baby-pink-13inchespomander-balls-garland-wedding-flowershang-or-floating-flower-ball-pink-wedding-rosesartificial-rose-balls-floating-flowersflower-balls-silk-rose-fuchsia-pink-small-pomanderfuchsia-pink-roses-kissing-ball-large-pomanderhydrangea-silk-flower-ball-fuchsia-10incheshydrangea-silk-flower-ball-fuchsia-6incheshanging-silk-flowers-kissing-ball-7inch-lavenderlavender-silk-rose-ball-10inch-hangingpurple-hanging-roses-flower-ball-small-pomanderpurple-8-5-inch-kissing-ball-large-roses-pomanderhydrangea-silk-flower-ball-purple-6inchesblue-flower-balls-roses-six-inches-pomanderblue-roses-hanging-kissing-balls-large-pomanderroyal-blue-small-round-kissing-flower-ball-pomanderdark-blue-roses-kissing-balls-flower-rose-ball-pomanderhydrangea-silk-flower-ball-dark-blue-10inchesflower-ball-roses-aqua-blue-6-inches-pomanderhanging-flower-ball-turquoise-blue-roses-small-pomanderaqua-blue-silk-rose-round-flower-ball-8-5-inches-pomanderturquoise-blue-large-rose-ball-kissing-balls-pomanderhydrangea-silk-flower-ball-blue-6incheshydrangea-silk-flower-ball-aqua-10incheshydrangea-silk-flower-ball-blue-10incheshydrangea-silk-flower-ball-royal-blue-10incheshydrangea-silk-flower-ball-royal-blue-6incheshanging-wedding-flowers-kissing-balls-on-ribbonflower-ball-apple-green-kissing-ball-pomanderapple-green-silk-roses-flower-ball-large-pomanderboxwood-ball-topiary-4-inches-event-centerpieceboxwood-topiary-ball-artificial-7inchesboxwood-topiary-ball-2-halves-10inchesboxwood-topiary-ball-2-halves-14inchesred-kissing-ball-flower-ball-6-inches-pomanderred-roses-ball-round-hanging-large-pomandersilk-kissing-ball-red-hanging-flowers-10inchred-silk-8inch-hydrangea-wedding-flowershydrangea-silk-flower-ball-red-6incheshydrangea-silk-flower-ball-red-10inchesfoam-petal-rose-ball-red-6inchesfoam-petal-rose-ball-red-10inchesfoam-petal-rose-ball-red-12inchesfoam-petal-rose-ball-red-13incheskissing-balls-orange-5-inch-round-pomanderorange-flower-kissing-ball-largeyellow-roses-round-flower-ball-kissing-ball-6inch-pomanderrose-ball-kissing-yellow-large-pomandersilver-roses-kissing-flower-ball-6inchessilver-wedding-kissing-ball-roses-8-5inchesgold-wedding-rose-flower-ball-6inchesgold-silk-roses-kissing-flower-ball-8-5inchesbrown-8-5-inch-roses-kissing-ball-pomanderblack-large-rose-flower-ball-pomanderrose-bud-silk-ivory-28inchesrose-bud-silk-red-28inchesaqua-silk-roses-flower-garland-8ftcoral-silk-roses-flower-garland-8ftpink-silk-roses-flower-garland-8ftfuchsia-silk-roses-flower-garland-8ftpurple-silk-roses-flower-garland-8ftroyalblue-silk-roses-flower-garland-8ftred-silk-roses-flower-garland-8ftwhite-silk-roses-flower-garland-8ft4pc-silk-rose-flower-wall-set-red4pc-silk-rose-flower-wall-set-white4pc-silk-rose-flower-wall-set-ivory4pc-silk-rose-flower-wall-set-pinkfoam-roses-wall-backdrop4-giant-ivory-real-feel-foam-roseslarge-pink-foam-flowers-wallscapejumbo-faux-flowers-with-removable-stemgiant-red-silk-flower-prophuge-flower-props-aisle-decorationsoversized-red-silk-rosesgigantic-silk-roses-removable-stemgiant-pink-silk-flowers-removable-stemjumbo-artificial-pink-roses-with-stemoversize-silk-flower-propsoversized-faux-flower-decorationsjumbo-ivory-silk-rose-propsgiant-silk-flowers-for-propshuge-ivory-silk-roses-removable-stemgiant-foam-floating-rose-with-stem-ivory-17inchhuge-white-foam-flower-20inch-wide20inch-wide-giant-foam-flower-ivory1inch-foam-roses-144pc-ivory-wedding-flowersmini-rose-set-144pc-white-1inch-foam-flowersfloating-foam-rose-stem-ivory-15inchesfloating-foam-rose-stem-white-15inchespink-floating-roses-2inch-foam-12pcsfoam-floating-pink-roses-3inch-12pcsfloating-foam-roses-pink-100pcsfloating-foam-rose-flowers-2inch-ivory-12pcsfloating-foam-roses-3inch-ivoryfloating-foam-roses-ivory-100pcsfloating-foam-roses-coral-100pcswhite-floating-foam-roses-12pcs-2inchwhite-wedding-roses-3inch-real-feel-foamfloating-foam-roses-white-100pcsreal-feel-dark-blue-floating-rosesfloating-roses-real-feel-foam-purple1https://s.yimg.com/aah/shopwildthings/rose-pomander-kissing-balls-88.jpghttps://s.yimg.com/aah/shopwildthings/rose-pomander-kissing-balls-89.jpg
Make sure to check out our huge selection of Vases and Centerpiece Risers that hold these beautifully. You can hang on Shepherd's Hooks to line a wedding ceremony aisle, add to Wedding Arches, hang from Manzanita Trees or simply place them on a table. These are ideal for flower girls to carry and you don't have to worry about them wilting or being crushed. To make them fancier add Strands of Beads or Acrylic Pendants!

We offer Silk and Foam Flower Balls in a fabulous selection of colors and sizes at affordable prices. A special feature of the foam balls is that you can float them in water and this looks absolutely gorgeous! Make your special day even more special with these Rose or Hydrangea Pomander Kissing Balls that are the ultimate in floral Decor!]]>
wild-pagefloral-walls-greenery-backdrops1https://s.yimg.com/aah/shopwildthings/flower-wall-16-1-2-x-24-silk-roses-hydrangeas-blush-pink-81.jpghttps://s.yimg.com/aah/shopwildthings/flower-wall-16-1-2-x-24-silk-roses-hydrangeas-blush-pink-82.jpg*The plastic frame is 15 3/4" by 23 1/2" but the flowers extend over the edges making the actual measurement about 16 1/2" by 24" and it's 2 1/2" to 3" deep. Full of classy Silk Roses that are about 4" in diameter and splendid Hydrangea flowers that are approx. 2" wide, this wall only weighs 12 oz. The colors on this mat are absolutely dreamy, the perfect mix of light pink rimmed with ivory and a touch of green leaves. Gorgeous! The flowers are attached to a sturdy, white plastic grid frame that is completely flexible. Two sides of the frame have plastic pegs which insert into the holes on the other two sides of the frame so you can attach as many mats as you need to cover areas small or large. The flowers extend over the edge of the mat so the grid is pretty well hidden. The mat is so flexible that you can actually attach the mat to itself, creating a circular floral vase! The plastic grids are 1" by 1 1/2" which makes it super easy to work with for attaching the frame to another surface or for intertwining Fairy String Lights. We'd recommend floral wire or wire ties as an extra measure for keeping them secure or simply staple-gun the mat to a solid surface. Create breath-taking wedding and event Decor by attaching to a trellis, gazebo or pavilion. Mix materials and fashion a stunning wall of flowers and Artificial Greenery & Foliage behind a head table which can double as an elegant photo backdrop. The plastic grid frame can easily be cut if need be. This Blush Pink Rose and Hydrangea Panel looks exceptional with Butterfly Garlands fluttering among the flowers. Budget friendly and lightweight, the design allows for many display possibilities and it works well to mask columns, walls and doors. Making over a ceiling with floral canopies is easier than ever with this awesome flower wall and for added glam, you can attach Sparkling Crystal Garlands and Pendants. Many, many ways to use this Floral Wall Mat to make your dream garden a reality! Take a peek here at Tina's Tips & Tricks Video to see flower panels up close, how to snap them together and how they look mounted on a wall. Also, please see the video below where Katie features this actual flower wall, as well as this style in other colors. TO AVOID THE LOOK OF "SEAMS" ON A FLOWER WALL USING A PIPE AND DRAPE STRUCTURE: The most critical point is to make sure that each wall panel is secured in multiple spots, not only to the pipes but to each adjoining panel as well. The tie should be a material that won't relax or stretch like burlap twine, wire ties or zip ties. When displaying multiple panels next to each other, each wall needs to be pulled taut so the seams don't show. The flowers extend over the frame, hiding the pipes while creating a seamless look. Another key is to secure each panel to the pipe AND to the adjoining panel in at least 3 spots. You can also connect the panels by using the pegs & holes on the sides of the plastic frame. Additionally, running picture wire horizontally, vertically and diagonally on the pipe and drape structure before adding the walls allows for a firmer background to support the walls.]]>floral-walls-greenery-backdrops silkflowers artificialgreenery using-flower-walls-wedding-event-backdropswild-pagefloral-walls-greenery-backdrops1https://s.yimg.com/aah/shopwildthings/flower-walls-backdrops-for-sale-50.jpghttps://s.yimg.com/aah/shopwildthings/flower-walls-backdrops-for-sale-51.jpg*The plastic frame is 15 3/4" by 23 1/2" but the flowers extend over the edges making the actual measurement about 16 1/2" by 24" and it's 2 1/2" deep. Full of classy Silk Roses that are about 3 1/2" in diameter and splendid Hydrangea flowers that are approx. 2" wide, this wall only weighs 12 oz. The flowers are attached to a sturdy, white plastic grid frame that is completely flexible. Two sides of the frame have plastic pegs which insert into the holes on the other two sides of the frame so you can attach as many mats as you need to cover areas small or large. The flowers extend over the edge of the mat so the grid is pretty well hidden. The mat is so flexible that you can actually attach the mat to itself, creating a circular floral vase! The plastic grids are 1" by 1 1/2" which makes it super easy to work with for attaching the frame to another surface or for intertwining Fairy String Lights. We'd recommend floral wire or wire ties as an extra measure for keeping them secure or simply staple-gun the mat to a solid surface. Create breath-taking wedding and event decor by attaching to a trellis, gazebo or pavilion. Mix materials and fashion a stunning wall of flowers and Artificial Greenery & Foliage behind a head table which can double as an elegant photo backdrop. The plastic grid frame can easily be cut if need be. This White Rose and Hydrangea Panel looks exceptional with a border of our Green Hydrangea Wall Mats. Budget friendly and lightweight, the design allows for many display possibilities and it works well to mask columns, walls and doors. Making over a ceiling with floral canopies is easier than ever with this awesome flower wall and for added glam, you can attach Sparkling Crystal Garlands and Pendants. Many, many ways to use this Floral Wall Mat to make your dream garden a reality! Take a peek here at Tina's Tips & Tricks Video to see flower panels up close, how to snap them together and how they look mounted on a wall. Also, please see the video below where Katie features this actual flower wall, as well as this style in other colors. TO AVOID THE LOOK OF "SEAMS" ON A FLOWER WALL USING A PIPE AND DRAPE STRUCTURE: The most critical point is to make sure that each wall panel is secured in multiple spots, not only to the pipes but to each adjoining panel as well. The tie should be a material that won't relax or stretch like burlap twine, wire ties or zip ties. When displaying multiple panels next to each other, each wall needs to be pulled taut so the seams don't show. The flowers extend over the frame, hiding the pipes while creating a seamless look. Another key is to secure each panel to the pipe AND to the adjoining panel in at least 3 spots. You can also connect the panels by using the pegs & holes on the sides of the plastic frame. Additionally, running picture wire horizontally, vertically and diagonally on the pipe and drape structure before adding the walls allows for a firmer background to support the walls.]]>floral-walls-greenery-backdrops silkflowers artificialgreenery effectively-using-spectacular-silk-flowerswild-pagefloral-walls-greenery-backdrops11https://s.yimg.com/aah/shopwildthings/silk-plumeria-frangipani-flower-walls-romantic-red-dark-seeds-16-x-24-44.jpghttps://s.yimg.com/aah/shopwildthings/silk-plumeria-frangipani-flower-walls-romantic-red-dark-seeds-16-x-24-45.jpg*The plastic frame is 15 1/2" by 23 1/2" but the flowers extend over the edges making the actual measurement about 17 1/2" by 24 1/2" and it's 2" deep. Chocked full of soft and luscious hydrangea blooms that are each approx. 2" wide. The coloring on this flower wall is awesome and the finish is semi-shiny. The lavish shade of red gets darker towards the center which has dark brown/black seeds. Lots of detail that adds up to lots of depth and visual impact on this wall! Truly fit for black-tie events! This mat only weighs 12 oz. which allows for many display possibilities. The flowers are attached to a sturdy, plastic grid frame that is completely flexible. Two sides of the frame have plastic pegs which insert into the holes on the other two sides of the frame so you can attach as many mats as you need to cover areas small or large. The flowers extend over the edge of the mat so the grid is pretty well hidden. The mat is so flexible that you can actually attach the mat to itself, creating a circular floral vase! The grids are an inch square which makes it super easy to work with for attaching the frame to another surface. Create breath-taking wedding and event decor by attaching to a trellis or an arch. Fashion a stunning wall of flowers behind a head table which can double as an elegant photo backdrop. Use to mask or enhance a column, wall or door and accent with a colorful rose monogram or logo to mark the occasion! If you want to create a design with other materials you can easily part the flowers and use the grid to attach items. If hanging from a wall or fence, use the grids to intertwine Fairy String Lights to give a soft illumination or create a border with a complementary color like our Semi-Gloss Black Flower Wall. Very classy! This mat is an ideal size to use on drop ceilings with metal grids. Create a magical floral canopy by suspending the mat with magnet hooks, crystal or pearl strands. Hang Sparkling Crystal Ornaments for added glam. If you need a wall that will be seen from both sides, use the easily accessible grids and tie 2 mats back-to-back. You can even cut the plastic grid frame to make creative shapes. Many, many ways to use this Floral Wall Mat to make your dream garden a reality! Take a peek here at Tina's Tips & Tricks Video to see flower panels up close, how to snap them together and how they look mounted on a wall. Also, please see the video below where Katie features this actual flower wall, as well as our red flower wall with white seeds! TO AVOID THE LOOK OF "SEAMS" ON A FLOWER WALL USING A PIPE AND DRAPE STRUCTURE: The most critical point is to make sure that each wall panel is secured in multiple spots, not only to the pipes but to each adjoining panel as well. The tie should be a material that won't relax or stretch like burlap twine, wire ties or zip ties. When displaying multiple panels next to each other, each wall needs to be pulled taut so the seams don't show. The flowers extend over the frame, hiding the pipes while creating a seamless look. Another key is to secure each panel to the pipe AND to the adjoining panel in at least 3 spots. You can also connect the panels by using the pegs & holes on the sides of the plastic frame. Additionally, running picture wire horizontally, vertically and diagonally on the pipe and drape structure before adding the walls allows for a firmer background to support the walls.]]>floral-walls-greenery-backdrops silkflowers gaandst using-flower-walls-wedding-event-backdropswild-pagewhclde11https://s.yimg.com/aah/shopwildthings/artificial-flower-wall-backdrop-22.jpghttps://s.yimg.com/aah/shopwildthings/artificial-flower-wall-backdrop-23.jpg*The frame is 15 3/4" by 23 1/4" but the flowers extend over the edges making the actual measurement about 17" x 24 1/2" and it's 1 1/2" deep. Chocked full of glorious Hydrangea flowers, each soft and luscious bloom is approx. 2" wide and this mat only weighs 12 oz. which allows for many display possibilities. This mat is a bit less dense than most we carry (hence the price difference between this mat and our Premium line) but attaching to a white backdrop works beautifully. The flowers are attached to a sturdy, plastic grid frame that is completely flexible. Two sides of the frame have plastic pegs which insert into the holes on the other two sides of the frame so you can attach as many mats as you need to cover areas small or large. The flowers extend over the edge of the mat and it's so flexible that you can actually attach the mat to itself, creating a circular floral vase! The grids are an inch square which makes it super easy to work with for attaching the frame to another surface. We'd recommend floral wire or wire ties as an extra measure for keeping them secured. Create breath-taking wedding and event decor by attaching to a trellis or Arch. Fashion a stunning wall of flowers behind a head table which can double as an elegant photo backdrop. Use to mask or enhance a column, wall or door and accent with a colorful rose monogram or logo to mark the occasion! If you want to create a design with other materials you can easily part the flowers and use the grid to attach items. If hanging from a wall or fence, use the grids to intertwine fairy string lights or create dimension with your flower wall by adding refreshing greenery like Silk Vines. This mat is an ideal size to use on drop ceilings with metal grids. Create a dreamy floral canopy by suspending the mat with magnet hooks, crystal or pearl strands. Hang Sparkling Crystal Ornaments for added glam. If you need a wall that will be seen from both sides, use the easily accessible grids and tie 2 mats back-to-back. You can even cut the plastic grid frame to make creative shapes. Many, many ways to use this Floral Wall Mat to make your dream garden a reality! TO AVOID THE LOOK OF "SEAMS" ON A FLOWER WALL USING A PIPE AND DRAPE STRUCTURE: The most critical point is to make sure that each wall panel is secured in multiple spots, not only to the pipes but to each adjoining panel as well. The tie should be a material that won't relax or stretch like burlap twine, wire ties or zip ties. When displaying multiple panels next to each other, each wall needs to be pulled taut so the seams don't show. The flowers extend over the frame, hiding the pipes while creating a seamless look. Another key is to secure each panel to the pipe AND to the adjoining panel in at least 3 spots. You can also connect the panels by using the pegs & holes on the sides of the plastic frame. Additionally, running picture wire horizontally, vertically and diagonally on the pipe and drape structure before adding the walls allows for a firmer background to support the walls. Please view our instructional video.]]>floral-walls-greenery-backdrops silkflowers wedding-decor using-flower-walls-wedding-event-backdropswild-pagestand-alone-flower-wall-backdrop-video-tutorial1https://s.yimg.com/aah/shopwildthings/small-roses-flower-wall-backdrop-64.jpghttps://s.yimg.com/aah/shopwildthings/small-roses-flower-wall-backdrop-65.jpg*The plastic frame is 15 1/2" by 23" but the flowers extend over the edges making the actual measurement about 17" by 25" and it's 4" deep! Chocked full of classy roses, each soft and silky bloom is approx. 1 1/2" wide and this wall only weighs 1.3 lb. This bed of roses adds an incredible amount of depth and dimension to any wallscape because the height of the flowers is staggered from 3" to 4" tall, just like natures' own beauties. Due to the extra long flowers on this wall, they tend to get a bit smashed during shipping. Gently fluff them up to regain their height and fullness. Cream is clean and very appealing, able to stand well on its own yet blends and complements every other color. The roses are attached to a sturdy, plastic grid frame that is completely flexible. To connect one or more mats, insert the plastic pegs on 1 wall into the holes on the 2nd wall and so on. You can attach as many mats as you need to cover areas small or large. The flowers extend over the edge of the mat so the grid is pretty well hidden. The mat is so flexible that you can actually attach the mat to itself, creating a circular floral vase! The grids are an inch square which makes it super easy to work with for attaching the frame to another surface or for intertwining Fairy String Lights. Create a monogram or craft a logo by attaching colorful flower garlands or other flowers to the plastic grid frame. We'd recommend floral wire or wire ties as an extra measure for keeping them secure or simply staple-gun the mat to a solid surface. Create breath-taking wedding and event decor by attaching to a trellis, gazebo or pavilion. Mix materials and fashion a stunning wall of flowers and Artificial Greenery & Foliage behind a head table which can double as an elegant photo backdrop. The plastic grid frame can easily be cut if need be. This Cream Rose Panel also makes an exceptional border for pink, purple, red or green floral wall mats like our Red Hydrangea Flower Wall or mixing with textures like our Boxwood Wall Mats creates a striking visual backdrop. Budget friendly and lightweight, the design allows for many display possibilities and it works well to mask columns, walls and doors. Making over a ceiling with floral canopies is easier than ever with this awesome flower wall and for added glam, you can attach Sparkling Crystal Garlands and Pendants. Many, many ways to use this Floral Wall Mat to make your dream garden a reality! TO AVOID THE LOOK OF "SEAMS" ON A FLOWER WALL USING A PIPE AND DRAPE STRUCTURE: The most critical point is to make sure that each wall panel is secured in multiple spots, not only to the pipes but to each adjoining panel as well. The tie should be a material that won't relax or stretch like burlap twine, wire ties or zip ties. When displaying multiple panels next to each other, each wall needs to be pulled taut so the seams don't show. The flowers extend over the frame, hiding the pipes while creating a seamless look. Another key is to secure each panel to the pipe AND to the adjoining panel in at least 3 spots. You can also connect the panels by using the pegs & holes on the sides of the plastic frame. Additionally, running picture wire horizontally, vertically and diagonally on the pipe and drape structure before adding the walls allows for a firmer background to support the walls. Please view our instructional video.]]>artificialgreenery floral-walls-greenery-backdrops silkflowers using-flower-walls-wedding-event-backdropswild-pagefloral-walls-greenery-backdrops1https://s.yimg.com/aah/shopwildthings/flower-wall-17-x-25-silk-cherry-blossoms-blush-pink-71.jpghttps://s.yimg.com/aah/shopwildthings/flower-wall-17-x-25-silk-cherry-blossoms-blush-pink-72.jpg*The plastic frame is 15 1/2" by 23 1/2" but the flowers extend over the edges making the actual measurement about 17" by 25" and it's 2" deep. Delicious Cherry Blossoms adorn this wall and each soft and silky bloom is approx. 2" wide and this wall only weighs 8.5 oz. The subtle blending of soft pink centers into ruffled ivory edges make this an elegant color to mix into any wedding or event Decor theme.

The flowers are attached to a sturdy, plastic grid frame that is completely flexible. Two sides of the frame have plastic pegs which insert into the holes on the other two sides of the frame so you can attach as many mats as you need to cover areas small or large. The flowers extend over the edge of the mat so the grid is pretty well hidden. The mat is so flexible that you can actually attach the mat to itself, creating a circular floral vase! The grids are an inch square which makes it super easy to work with for attaching the frame to another surface or for intertwining Fairy String Lights.

We'd recommend floral wire or wire ties as an extra measure for keeping them secure or simply staple-gun the mat to a solid surface. Create breath-taking wedding and event Decor by attaching to a trellis, gazebo or pavilion. Mix materials and fashion a stunning wall of flowers and Artificial Greenery & Foliage behind a head table which can double as an elegant photo backdrop. The plastic grid frame can easily be cut if need be.

Budget friendly and lightweight, the design allows for many display possibilities and it works well to mask columns, walls and doors. Making over a ceiling with floral canopies is easier than ever with this awesome flower wall and for added glam, you can attach Sparkling Crystal Garlands and Pendants.

Many, many ways to use this Floral Wall Mat to make your dream garden a reality! Take a peek here at Tina's Tips & Tricks Video to see flower panels up close, how to snap them together and how they look mounted on a wall. Also, please see the video below where Katie features this actual flower wall, as well as our cream & white cherry blossom flower wall! TO AVOID THE LOOK OF "SEAMS" ON A FLOWER WALL USING A PIPE AND DRAPE STRUCTURE:
The most critical point is to make sure that each wall panel is secured in multiple spots, not only to the pipes but to each adjoining panel as well. The tie should be a material that won't relax or stretch like burlap twine, wire ties or zip ties. When displaying multiple panels next to each other, each wall needs to be pulled taut so the seams don't show. The flowers extend over the frame, hiding the pipes while creating a seamless look.

Another key is to secure each panel to the pipe AND to the adjoining panel in at least 3 spots. You can also connect the panels by using the pegs & holes on the sides of the plastic frame. Additionally, running picture wire horizontally, vertically and diagonally on the pipe and drape structure before adding the walls allows for a firmer background to support the walls.

Please view our instructional video.
floral-walls-greenery-backdrops silkflowers artificialgreenery using-flower-walls-wedding-event-backdrops
wild-pagefloral-walls-greenery-backdrops1https://s.yimg.com/aah/shopwildthings/flower-wall-17-x-25-silk-cherry-blossoms-cream-white-80.jpghttps://s.yimg.com/aah/shopwildthings/flower-wall-17-x-25-silk-cherry-blossoms-cream-white-81.jpg*The plastic frame is 15 1/2" by 23 1/2" but the flowers extend over the edges making the actual measurement about 17" by 25" and it's 2" deep. Delicious Cherry Blossoms adorn this wall and each soft and silky bloom is approx. 2" wide and this wall only weighs 8.5 oz. The subtle blending of light creamy centers into ruffled white edges make this an elegant color to mix into any wedding or event Decor theme.

The flowers are attached to a sturdy, plastic grid frame that is completely flexible. Two sides of the frame have plastic pegs which insert into the holes on the other two sides of the frame so you can attach as many mats as you need to cover areas small or large. The flowers extend over the edge of the mat so the grid is pretty well hidden. The mat is so flexible that you can actually attach the mat to itself, creating a circular floral vase! The grids are an inch square which makes it super easy to work with for attaching the frame to another surface or for intertwining Fairy String Lights.

We'd recommend floral wire or wire ties as an extra measure for keeping them secure or simply staple-gun the mat to a solid surface. Create breath-taking wedding and event Decor by attaching to a trellis, gazebo or pavilion. Mix materials and fashion a stunning wall of flowers and Artificial Greenery & Foliage behind a head table which can double as an elegant photo backdrop. The plastic grid frame can easily be cut if need be.

Budget friendly and lightweight, the design allows for many display possibilities and it works well to mask columns, walls and doors. Making over a ceiling with floral canopies is easier than ever with this awesome flower wall and for added glam, you can attach Sparkling Crystal Garlands and Pendants.

Many, many ways to use this Floral Wall Mat to make your dream garden a reality! Take a peek here at Tina's Tips & Tricks Video to see flower panels up close, how to snap them together and how they look mounted on a wall. Also, please see the video below where Katie features this actual flower wall, as well as our blush pink cherry blossom flower wall! TO AVOID THE LOOK OF "SEAMS" ON A FLOWER WALL USING A PIPE AND DRAPE STRUCTURE:
The most critical point is to make sure that each wall panel is secured in multiple spots, not only to the pipes but to each adjoining panel as well. The tie should be a material that won't relax or stretch like burlap twine, wire ties or zip ties. When displaying multiple panels next to each other, each wall needs to be pulled taut so the seams don't show. The flowers extend over the frame, hiding the pipes while creating a seamless look.

Another key is to secure each panel to the pipe AND to the adjoining panel in at least 3 spots. You can also connect the panels by using the pegs & holes on the sides of the plastic frame. Additionally, running picture wire horizontally, vertically and diagonally on the pipe and drape structure before adding the walls allows for a firmer background to support the walls.

Please view our instructional video.
floral-walls-greenery-backdrops silkflowers artificialgreenery using-flower-walls-wedding-event-backdrops
wild-pagefloral-walls-greenery-backdrops1https://s.yimg.com/aah/shopwildthings/blush-pink-flower-wall-panel-shopwildthings-46.jpghttps://s.yimg.com/aah/shopwildthings/blush-pink-flower-wall-panel-shopwildthings-47.jpg*The plastic frame on each mat is bendable and measures 15 1/2" x 23 1/2" but the flowers extend over the edges making the actual measurement about 17" by 25" and it is 2" deep. This mat is full of luscious hydrangea blooms, each approx. 2" wide. This mat only weighs 12 oz. which allows for many display possibilities. The flowers are attached to a sturdy, plastic grid frame that is completely flexible. Two sides of the frame have plastic pegs which insert into the holes on the other two sides of the frame so you can attach as many mats as you need to cover areas small or large. Use to mask or enhance a column, wall or door and it's so flexible that you can actually attach the mat to itself, creating a circular floral vase! The large grids make it super easy to staple gun this frame to another surface. We recommend floral wire or wire ties as an extra measure for keeping them secured. Create breath-taking wedding and event Decor by creating a stunning wall of flowers behind a head table which can double as an elegant photo backdrop. The velvety soft blooms and subtle pink shade makes an ideal playground for Sparkling Butterflies and it's just the right size to use on drop ceilings with metal grids. Create an elegant floral canopy by suspending the mat with magnet hooks and intertwine Fairy String Lights or hang Sparkling Crystal Ornaments for added glam. Many, many ways to use this Floral Wall Mat to make your dream garden a reality! Take a peek here at Tina's Tips & Tricks Video to see flower panels up close, how to snap them together and how they look mounted on a wall. Also, please see the video below where Katie features this actual flower wall, as well as our pink and cream hydrangea flower wall! TO AVOID THE LOOK OF "SEAMS" ON A FLOWER WALL USING A PIPE AND DRAPE STRUCTURE: The most critical point is to make sure that each wall panel is secured in multiple spots, not only to the pipes but to each adjoining panel as well. The tie should be a material that won't relax or stretch like burlap twine, wire ties or zip ties. When displaying multiple panels next to each other, each wall needs to be pulled taut so the seams don't show. The flowers extend over the frame, hiding the pipes while creating a seamless look. Another key is to secure each panel to the pipe AND to the adjoining panel in at least 3 spots. You can also connect the panels by using the pegs & holes on the sides of the plastic frame. Additionally, running picture wire horizontally, vertically and diagonally on the pipe and drape structure before adding the walls allows for a firmer background to support the walls.]]>floral-walls-greenery-backdrops silkflowers artificialgreenery using-flower-walls-wedding-event-backdropswild-pagepurplestuff1https://s.yimg.com/aah/shopwildthings/flower-wall-17-x-25-silk-hydrangeas-purple-33.jpghttps://s.yimg.com/aah/shopwildthings/flower-wall-17-x-25-silk-hydrangeas-purple-34.jpg*The plastic frame on each mat is bendable and measures 15 1/2" x 23 1/2" but the flowers extend over the edges making the actual measurement about 17" by 25" and it is 2" deep. This mat is full of luscious hydrangea blooms, each approx. 2" wide. The blooms randomly alter from a deep purple with dark violet centers, to medium blue violet petals and the varying colors add lots of texture and dimension! This mat only weighs 12 oz. which allows for many display possibilities. The flowers are attached to a sturdy, plastic grid frame that is completely flexible. Two sides of the frame have plastic pegs which insert into the holes on the other two sides of the frame so you can attach as many mats as you need to cover areas small or large. Use to mask or enhance a column, wall or door and it's so flexible that you can actually attach the mat to itself, creating a circular floral vase! The large grids make it super easy to staple gun this frame to another surface. We recommend floral wire or wire ties as an extra measure for keeping them secured. Create breath-taking wedding and event decor by creating a stunning wall of flowers behind a head table which can double as an elegant photo backdrop. The velvety soft blooms make an ideal playground for Sparkling Butterfly Garlands and it's just the right size to use on drop ceilings with metal grids. Create an elegant floral canopy by suspending the mat with magnet hooks and intertwine Fairy String Lights or hang Sparkling Crystal Ornaments for added glam. Many, many ways to use this Floral Wall Mat to make your dream garden a reality! Take a peek here at Tina's Tips & Tricks Video to see flower panels up close, how to snap them together and how they look mounted on a wall. Also, please see the video below where Katie features this actual flower wall! TO AVOID THE LOOK OF "SEAMS" ON A FLOWER WALL USING A PIPE AND DRAPE STRUCTURE: The most critical point is to make sure that each wall panel is secured in multiple spots, not only to the pipes but to each adjoining panel as well. The tie should be a material that won't relax or stretch like burlap twine, wire ties or zip ties. When displaying multiple panels next to each other, each wall needs to be pulled taut so the seams don't show. The flowers extend over the frame, hiding the pipes while creating a seamless look. Another key is to secure each panel to the pipe AND to the adjoining panel in at least 3 spots. You can also connect the panels by using the pegs & holes on the sides of the plastic frame. Additionally, running picture wire horizontally, vertically and diagonally on the pipe and drape structure before adding the walls allows for a firmer background to support the walls.]]>floral-walls-greenery-backdrops silkflowers artificialgreenery using-flower-walls-wedding-event-backdropswild-pagefloral-walls-greenery-backdrops1https://s.yimg.com/aah/shopwildthings/flower-wall-green-hydrangea-27.jpghttps://s.yimg.com/aah/shopwildthings/flower-wall-green-hydrangea-28.jpg*The plastic frame is 16" by 23 5/8" but the flowers extend over the edges making the actual measurement about 17" by 25" and it's 2" deep. Chocked full of splendid Hydrangea flowers, each soft and silky bloom is approx. 2" wide and this wall only weighs 12 oz. The shade of green on this wall builder is so natural looking - very appealing and inviting. Soft green with touches of cream-tipped petals interspersed throughout. The flowers are attached to a sturdy, plastic grid frame that is completely flexible. Two sides of the frame have plastic pegs which insert into the holes on the other two sides of the frame so you can attach as many mats as you need to cover areas small or large. The flowers extend over the edge of the mat so the grid is pretty well hidden. The mat is so flexible that you can actually attach the mat to itself, creating a circular floral vase! The grids are an inch square which makes it super easy to work with for attaching the frame to another surface or for intertwining Fairy String Lights. We'd recommend floral wire or wire ties as an extra measure for keeping them secure or simply staple-gun the mat to a solid surface. Create breath-taking wedding and event Decor by attaching to a trellis, gazebo or pavilion. Mix materials and fashion a stunning wall of flowers and Artificial Greenery & Foliage behind a head table which can double as an elegant photo backdrop. The plastic grid frame can easily be cut if need be. This Green Hydrangea Panel makes an exceptional border for other white, ivory or cream floral wall mats like our Cream Silk Roses and Hydrangea Wall and our Giant Paper Flowers look extra classy against this backdrop. Budget friendly and lightweight, the design allows for many display possibilities and it works well to mask columns, walls and doors. Making over a ceiling with floral canopies is easier than ever with this awesome flower wall and for added glam, you can attach Sparkling Crystal Garlands and Pendants. Many, many ways to use this Floral Wall Mat to make your dream garden a reality! Take a peek here at Tina's Tips & Tricks Video to see flower panels up close, how to snap them together and how they look mounted on a wall. Also, please see the video below where Katie features this actual flower wall! TO AVOID THE LOOK OF "SEAMS" ON A FLOWER WALL USING A PIPE AND DRAPE STRUCTURE: The most critical point is to make sure that each wall panel is secured in multiple spots, not only to the pipes but to each adjoining panel as well. The tie should be a material that won't relax or stretch like burlap twine, wire ties or zip ties. When displaying multiple panels next to each other, each wall needs to be pulled taut so the seams don't show. The flowers extend over the frame, hiding the pipes while creating a seamless look. Another key is to secure each panel to the pipe AND to the adjoining panel in at least 3 spots. You can also connect the panels by using the pegs & holes on the sides of the plastic frame. Additionally, running picture wire horizontally, vertically and diagonally on the pipe and drape structure before adding the walls allows for a firmer background to support the walls. Please view our instructional video.]]>floral-walls-greenery-backdrops silkflowers artificialgreenery using-flower-walls-wedding-event-backdropswild-pagefloral-walls-greenery-backdrops1https://s.yimg.com/aah/shopwildthings/ivory-flower-wall-hydrangeas-48.jpghttps://s.yimg.com/aah/shopwildthings/ivory-flower-wall-hydrangeas-49.jpg*The plastic frame is 15 1/2" by 23" but the flowers extend over the edges making the actual measurement about 17" by 25" and it's 2" deep. Chocked full of splendid Hydrangea flowers, each soft and silky bloom is approx. 2" wide and this wall only weighs 12 oz. Ivory is clean and very appealing, able to stand well on its own yet blends and complements every other color. The flowers are attached to a sturdy, plastic grid frame that is completely flexible. Two sides of the frame have plastic pegs which insert into the holes on the other two sides of the frame so you can attach as many mats as you need to cover areas small or large. The flowers extend over the edge of the mat so the grid is pretty well hidden. The mat is so flexible that you can actually attach the mat to itself, creating a circular floral vase! The grids are an inch square which makes it super easy to work with for attaching the frame to another surface or for intertwining Fairy String Lights. Create a monogram or craft a logo by attaching colorful flower garlands to the plastic grid frame. We'd recommend floral wire or wire ties as an extra measure for keeping them secure or simply staple-gun the mat to a solid surface. Create breath-taking wedding and event Decor by attaching to a trellis, gazebo or pavilion. Mix materials and fashion a stunning wall of flowers and Artificial Greenery & Foliage behind a head table which can double as an elegant photo backdrop. The plastic grid frame can easily be cut if need be. This Ivory Hydrangea Panel makes an exceptional border for pink or green floral wall mats like our Blush Pink, Peach & Ivory Flower Wall or mixing with textures like our Boxwood Wall Mats creates a striking visual backdrop. Budget friendly and lightweight, the design allows for many display possibilities and it works well to mask columns, walls and doors. Making over a ceiling with floral canopies is easier than ever with this awesome flower wall and for added glam, you can attach Sparkling Crystal Garlands and Pendants. Many, many ways to use this Floral Wall Mat to make your dream garden a reality! Take a peek here at Tina's Tips & Tricks Video to see flower panels up close, how to snap them together and how they look mounted on a wall. Also, please see the video below where Katie features this actual flower wall! TO AVOID THE LOOK OF "SEAMS" ON A FLOWER WALL USING A PIPE AND DRAPE STRUCTURE: The most critical point is to make sure that each wall panel is secured in multiple spots, not only to the pipes but to each adjoining panel as well. The tie should be a material that won't relax or stretch like burlap twine, wire ties or zip ties. When displaying multiple panels next to each other, each wall needs to be pulled taut so the seams don't show. The flowers extend over the frame, hiding the pipes while creating a seamless look. Another key is to secure each panel to the pipe AND to the adjoining panel in at least 3 spots. You can also connect the panels by using the pegs & holes on the sides of the plastic frame. Additionally, running picture wire horizontally, vertically and diagonally on the pipe and drape structure before adding the walls allows for a firmer background to support the walls.]]>floral-backdrop-wedding-photo-wall-white floral-walls-greenery-backdrops silkflowers artificialgreenery effectively-using-spectacular-silk-flowerswild-pagewhclde11https://s.yimg.com/aah/shopwildthings/flower-wall-17-x-25-silk-hydrangeas-cream-41.jpghttps://s.yimg.com/aah/shopwildthings/flower-wall-17-x-25-silk-hydrangeas-cream-42.jpg*The plastic frame is 15 1/2" by 23" but the flowers extend over the edges making the actual measurement about 17" by 25" and it's 2" deep. Chocked full of splendid Hydrangea flowers, each soft and silky bloom is approx. 2" wide and this wall only weighs 12 oz. The light cream color is fresh and very appealing, able to stand well on its own yet blends and complements every other color. The flowers are attached to a sturdy, plastic grid frame that is completely flexible. Two sides of the frame have plastic pegs which insert into the holes on another side of the frame so you can attach as many mats as you need to cover areas small or large. The flowers extend over the edge of the mat so the grid is pretty well hidden. The mat is so flexible that you can actually attach the mat to itself, creating a circular floral vase! The grids are an inch square which makes it super easy to work with for attaching the frame to another surface or for intertwining Fairy String Lights. Create a monogram or craft a logo by attaching colorful flower garlands to the plastic grid frame. We'd recommend floral wire or wire ties as an extra measure for keeping them secure or simply staple-gun the mat to a solid surface. Create breath-taking wedding and event decor by attaching to a trellis, gazebo or pavilion. Mix materials and fashion a stunning wall of flowers and Artificial Greenery & Foliage behind a head table which can double as an elegant photo backdrop. The plastic grid frame can easily be cut if need be. This Light Cream Hydrangea Panel makes an exceptional border for other textured wall mats like our Blush Pink Roses & Hydrangeas Flower Wall or mixing with luscious greenery like our Boxwood Wall Mat creates a striking visual backdrop. Budget friendly and lightweight, the design allows for many display possibilities and it works well to mask columns, walls and doors. Making over a ceiling with floral canopies is easier than ever with this awesome flower wall and for added glam, you can attach Sparkling Crystal Garlands and Pendants. Many, many ways to use this Floral Wall Mat to make your dream garden a reality! TO AVOID THE LOOK OF "SEAMS" ON A FLOWER WALL USING A PIPE AND DRAPE STRUCTURE: The most critical point is to make sure that each wall panel is secured in multiple spots, not only to the pipes but to each adjoining panel as well. The tie should be a material that won't relax or stretch like burlap twine, wire ties or zip ties. When displaying multiple panels next to each other, each wall needs to be pulled taut so the seams don't show. The flowers extend over the frame, hiding the pipes while creating a seamless look. Another key is to secure each panel to the pipe AND to the adjoining panel in at least 3 spots. You can also connect the panels by using the pegs & holes on the sides of the plastic frame. Additionally, running picture wire horizontally, vertically and diagonally on the pipe and drape structure before adding the walls allows for a firmer background to support the walls. Please view our instructional video.]]>silk-flower-garlands floral-walls-greenery-backdrops silkflowers artificialgreenery using-flower-walls-wedding-event-backdropswild-pagegolddecor1https://s.yimg.com/aah/shopwildthings/flower-wall-17-x-25-silk-hydrangeas-metallic-gold-27.jpghttps://s.yimg.com/aah/shopwildthings/flower-wall-17-x-25-silk-hydrangeas-metallic-gold-28.jpg*The plastic frame on each mat is bendable and measures 15 1/2" x 23 1/2" but the flowers extend over the edges making the actual measurement about 17" by 25" and it is 2" deep. This mat is full of luscious hydrangea blooms, each approx. 2" wide. The petals are two-toned and feature a bright metallic gold finish with muted metallic gold edges. This flower wall is simply stunning and it almost glows! Perfect for black-tie events and anniversary celebrations. This mat only weighs 12 oz. which allows for many display possibilities. The flowers are attached to a sturdy, plastic grid frame that is completely flexible. Two sides of the frame have plastic pegs which insert into the holes on the other two sides of the frame so you can attach as many mats as you need to cover areas small or large. Use to mask or enhance a column, wall or door and it's so flexible that you can actually attach the mat to itself, creating a circular floral vase! The large grids make it super easy to staple gun this frame to another surface. We recommend floral wire or wire ties as an extra measure for keeping them secured. Create breath-taking wedding and event decor by creating a stunning wall of flowers behind a head table which can double as an elegant photo backdrop. Alternate panels with our Metallic Silver Flower Wall for a show-stopping silver and gold themed party! And, these mats are just the right size to use on drop ceilings with metal grids. Create an elegant floral canopy by suspending the mat with magnet hooks and intertwine Fairy String Lights, hang sparkling crystal pendants or add a monogram or logo using colorful, Flexible Flower Garlands! Many, many ways to use this Floral Wall Mat to make your dream garden a reality! Take a peek here at Tina's Tips & Tricks Video to see flower panels up close, how to snap them together and how they look mounted on a wall. Also, please see the video below where Katie features this actual flower wall, as well as our metallic silver wall! TO AVOID THE LOOK OF "SEAMS" ON A FLOWER WALL USING A PIPE AND DRAPE STRUCTURE: The most critical point is to make sure that each wall panel is secured in multiple spots, not only to the pipes but to each adjoining panel as well. The tie should be a material that won't relax or stretch like burlap twine, wire ties or zip ties. When displaying multiple panels next to each other, each wall needs to be pulled taut so the seams don't show. The flowers extend over the frame, hiding the pipes while creating a seamless look. Another key is to secure each panel to the pipe AND to the adjoining panel in at least 3 spots. You can also connect the panels by using the pegs & holes on the sides of the plastic frame. Additionally, running picture wire horizontally, vertically and diagonally on the pipe and drape structure before adding the walls allows for a firmer background to support the walls.]]>floral-walls-greenery-backdrops silkflowers artificialgreenery using-flower-walls-wedding-event-backdropswild-pagesilverdecor1https://s.yimg.com/aah/shopwildthings/flower-wall-17-x-25-silk-hydrangeas-metallic-silver-27.jpghttps://s.yimg.com/aah/shopwildthings/flower-wall-17-x-25-silk-hydrangeas-metallic-silver-28.jpg*The plastic frame on each mat is bendable and measures 15 1/2" x 23 1/2" but the flowers extend over the edges making the actual measurement about 17" by 25" and it is 2" deep. This mat is full of luscious hydrangea blooms, each approx. 2" wide. Lots of dimension is created with the two-toned petals that feature a bright metallic silver finish with muted metallic silver edges. This flower wall is simply stunning and it almost glows! Perfect for black-tie events and anniversary celebrations. This mat only weighs 12 oz. which allows for many display possibilities. The flowers are attached to a sturdy, plastic grid frame that is completely flexible. Two sides of the frame have plastic pegs which insert into the holes on the other two sides of the frame so you can attach as many mats as you need to cover areas small or large. Use to mask or enhance a column, wall or door and it's so flexible that you can actually attach the mat to itself, creating a circular floral vase! The large grids make it super easy to staple gun this frame to another surface. We recommend floral wire or wire ties as an extra measure for keeping them secured. Create breath-taking wedding and event decor by creating a stunning wall of flowers behind a head table which can double as an elegant photo backdrop. This is the perfect playground for Sparkling Butterfly Garlands or alternate panels with our Metallic Gold Flower Walls for a show-stopping silver and gold themed party! And, these mats are just the right size to use on drop ceilings with metal grids. Create an elegant floral canopy by suspending the mat with magnet hooks and intertwine Fairy String Lights, hang sparkling crystal pendants or add a monogram or logo using colorful, Flexible Silk Flower Garlands! Many, many ways to use this Floral Wall Mat to make your dream garden a reality! Take a peek here at Tina's Tips & Tricks Video to see flower panels up close, how to snap them together and how they look mounted on a wall. Also, please see the video below where Katie features this actual flower wall, as well as our metallic gold wall! TO AVOID THE LOOK OF "SEAMS" ON A FLOWER WALL USING A PIPE AND DRAPE STRUCTURE: The most critical point is to make sure that each wall panel is secured in multiple spots, not only to the pipes but to each adjoining panel as well. The tie should be a material that won't relax or stretch like burlap twine, wire ties or zip ties. When displaying multiple panels next to each other, each wall needs to be pulled taut so the seams don't show. The flowers extend over the frame, hiding the pipes while creating a seamless look. Another key is to secure each panel to the pipe AND to the adjoining panel in at least 3 spots. You can also connect the panels by using the pegs & holes on the sides of the plastic frame. Additionally, running picture wire horizontally, vertically and diagonally on the pipe and drape structure before adding the walls allows for a firmer background to support the walls.]]>floral-walls-greenery-backdrops silkflowers artificialgreenery using-flower-walls-wedding-event-backdropswild-pagefloral-walls-greenery-backdrops1https://s.yimg.com/aah/shopwildthings/flower-wall-pink-cream-43.jpghttps://s.yimg.com/aah/shopwildthings/flower-wall-pink-cream-44.jpg*The plastic frame is 16" by 23 5/8" but the flowers extend over the edges making the actual measurement about 17" by 25" and it's 2" deep. Chocked full of splendid Hydrangea flowers, each soft and silky bloom is approx. 2" wide and this wall only weighs 12 oz. The color of this pink and cream flower wall builder is so gorgeous and the variegated petals give amazing depth and visual interest. Some flowers are all pink and some have a pink and cream mix. The flowers are attached to a sturdy, plastic grid frame that is completely flexible. Two sides of the frame have plastic pegs which insert into the holes on the other two sides of the frame so you can attach as many mats as you need to cover areas small or large. The flowers extend over the edge of the mat so the grid is pretty well hidden. The mat is so flexible that you can actually attach the mat to itself, creating a circular floral vase! The grids are an inch square which makes it super easy to work with for attaching the frame to another surface or for intertwining Fairy String Lights. We'd recommend floral wire or wire ties as an extra measure for keeping them secure or simply staple-gun the mat to a solid surface. Create breath-taking wedding and event Decor by attaching to a trellis, gazebo or pavilion. Mix materials and fashion a stunning wall of flowers and Artificial Greenery & Foliage behind a head table which can double as an elegant photo backdrop. The plastic grid frame can easily be cut if need be. Budget friendly and lightweight, the design allows for many display possibilities and it works well to mask columns, walls and doors. Making over a ceiling with floral canopies is easier than ever with this awesome flower wall and for added glam, you can attach Sparkling Crystal Garlands and Pendants. Many, many ways to use this Floral Wall Mat to make your dream garden a reality! Take a peek here at Tina's Tips & Tricks Video to see flower panels up close, how to snap them together and how they look mounted on a wall. Also, please see the video below where Katie features this actual flower wall, as well as our blush pink hydrangea flower wall! TO AVOID THE LOOK OF "SEAMS" ON A FLOWER WALL USING A PIPE AND DRAPE STRUCTURE: The most critical point is to make sure that each wall panel is secured in multiple spots, not only to the pipes but to each adjoining panel as well. The tie should be a material that won't relax or stretch like burlap twine, wire ties or zip ties. When displaying multiple panels next to each other, each wall needs to be pulled taut so the seams don't show. The flowers extend over the frame, hiding the pipes while creating a seamless look. Another key is to secure each panel to the pipe AND to the adjoining panel in at least 3 spots. You can also connect the panels by using the pegs & holes on the sides of the plastic frame. Additionally, running picture wire horizontally, vertically and diagonally on the pipe and drape structure before adding the walls allows for a firmer background to support the walls.]]>floral-walls-greenery-backdrops silkflowers artificialgreenery effectively-using-spectacular-silk-flowerswild-pagefloral-walls-greenery-backdrops1https://s.yimg.com/aah/shopwildthings/white-hydrangea-flower-wall-shopwildthings-47.jpghttps://s.yimg.com/aah/shopwildthings/white-hydrangea-flower-wall-shopwildthings-48.jpg*The plastic frame is 15 1/2" by 23" but the flowers extend over the edges making the actual measurement about 17" by 25" and it's 2" deep. Chocked full of splendid Hydrangea flowers, each soft and silky bloom is approx. 2" wide and this wall only weighs 12 oz. White is clean and very appealing, able to stand well on its own yet blends and complements every other color. The flowers are attached to a sturdy, plastic grid frame that is completely flexible. Two sides of the frame have plastic pegs which insert into the holes on the other two sides of the frame so you can attach as many mats as you need to cover areas small or large. The flowers extend over the edge of the mat so the grid is pretty well hidden. The mat is so flexible that you can actually attach the mat to itself, creating a circular floral vase! The grids are an inch square which makes it super easy to work with for attaching the frame to another surface or for intertwining Fairy String Lights. Create a monogram or craft a logo by attaching colorful flower garlands to the plastic grid frame. We'd recommend floral wire or wire ties as an extra measure for keeping them secure or simply staple-gun the mat to a solid surface. Create breath-taking wedding and event decor by attaching to a trellis, gazebo or pavilion. Mix materials and fashion a stunning wall of flowers and Artificial Greenery & Foliage behind a head table which can double as an elegant photo backdrop. The plastic grid frame can easily be cut if need be. This White Hydrangea Panel makes an exceptional border for other colorful wall mats like our Romantic Red Plumeria Flower Wall or mixing with textures like our Boxwood Wall Mat creates a striking visual backdrop. Budget friendly and lightweight, the design allows for many display possibilities and it works well to mask columns, walls and doors. Making over a ceiling with floral canopies is easier than ever with this awesome flower wall and for added glam, you can attach Sparkling Crystal Garlands and Pendants. Many, many ways to use this Floral Wall Mat to make your dream garden a reality! TO AVOID THE LOOK OF "SEAMS" ON A FLOWER WALL USING A PIPE AND DRAPE STRUCTURE: The most critical point is to make sure that each wall panel is secured in multiple spots, not only to the pipes but to each adjoining panel as well. The tie should be a material that won't relax or stretch like burlap twine, wire ties or zip ties. When displaying multiple panels next to each other, each wall needs to be pulled taut so the seams don't show. The flowers extend over the frame, hiding the pipes while creating a seamless look. Another key is to secure each panel to the pipe AND to the adjoining panel in at least 3 spots. You can also connect the panels by using the pegs & holes on the sides of the plastic frame. Additionally, running picture wire horizontally, vertically and diagonally on the pipe and drape structure before adding the walls allows for a firmer background to support the walls. Please view our instructional video.]]>ivory-flower-wall-wedding-backdrop floral-walls-greenery-backdrops silkflowers artificialgreenery using-flower-walls-wedding-event-backdropswild-pagefloral-walls-greenery-backdrops1https://s.yimg.com/aah/shopwildthings/flower-walls-pink-shopwildthings-63.jpghttps://s.yimg.com/aah/shopwildthings/flower-walls-pink-shopwildthings-64.jpg*The plastic frame is 16" by 23 1/2" but the flowers extend over the edges making the actual measurement about 18" by 25" and it's 2" deep. Build a glorious flower wall using this stunning mix of Big Juicy Pink Roses and Hydrangea Blossoms! The Pink Roses are 4 inches wide and the Hydrangeas are 2" wide. The hydrangea have variations from bloom to bloom, which really adds depth to the entire piece. Some of the blooms have white to light pink centers and some have darker pink insides that are tipped with light pink or white. This causes there to be a stunning amount of depth and interest to the wall. This mat only weighs 12 oz. which allows for many display possibilities. The flowers are attached to a sturdy, plastic grid frame that is completely flexible. Two sides of the frame have plastic pegs which insert into the holes on the other two sides of the frame so you can attach as many mats as you need to cover areas small or large. The flowers extend over the edge of the mat so the grid is pretty well hidden. The mat is so flexible that you can actually attach the mat to itself, creating a circular floral vase! The grids are an inch square which makes it super easy to work with for attaching the frame to another surface. Create breath-taking wedding and event Decor by attaching to a trellis or Arch. Fashion a stunning wall of flowers behind a head table which can double as an elegant photo backdrop. Use to mask or enhance a column, wall or door and accent with a colorful rose monogram or logo to mark the occasion! If you want to create a design with other materials you can easily part the flowers and use the grid to attach items. If hanging from a wall or fence, use the grids to intertwine fairy string lights or create dimension with your flower wall by adding beautiful Draping Blossoms. This mat is an ideal size to use on drop ceilings with metal grids. Create a dreamy floral canopy by suspending the mat with magnet hooks, crystal or pearl strands. Hang Sparkling Crystal Ornaments for added glam. If you need a wall that will be seen from both sides, use the easily accessible grids and tie 2 mats back-to-back. You can even cut the plastic grid frame to make creative shapes. Many, many ways to use this Floral Wall Mat to make your dream garden a reality! Take a peek here at Tina's Tips & Tricks Video to see flower panels up close, how to snap them together and how they look mounted on a wall. Also, please see the video below where Katie features this actual flower wall, as well as this style in other colors. TO AVOID THE LOOK OF "SEAMS" ON A FLOWER WALL USING A PIPE AND DRAPE STRUCTURE: The most critical point is to make sure that each wall panel is secured in multiple spots, not only to the pipes but to each adjoining panel as well. The tie should be a material that won't relax or stretch like burlap twine, wire ties or zip ties. When displaying multiple panels next to each other, each wall needs to be pulled taut so the seams don't show. The flowers extend over the frame, hiding the pipes while creating a seamless look. Another key is to secure each panel to the pipe AND to the adjoining panel in at least 3 spots. You can also connect the panels by using the pegs & holes on the sides of the plastic frame. Additionally, running picture wire horizontally, vertically and diagonally on the pipe and drape structure before adding the walls allows for a firmer background to support the walls.]]>silkflowers gaandst fuchsia-silk-roses-flower-garland-8ft using-flower-walls-wedding-event-backdropswild-pagefloral-walls-greenery-backdrops1https://s.yimg.com/aah/shopwildthings/silk-plumeria-frangipant-flower-wall-mat-ivory-16-x-2-58.jpghttps://s.yimg.com/aah/shopwildthings/silk-plumeria-frangipant-flower-wall-mat-ivory-16-x-2-59.jpg*The frame is 15 3/4" by 23" but the flowers extend over the edges making the actual measurement about 18" x 26" and it's 2" deep. Chocked full of the glorious Hawaiian Frangipani Flower, each soft and luscious bloom is approx. 2" wide. This mat only weighs 12 oz. which allows for many display possibilities. The flowers are attached to a sturdy, plastic grid frame that is completely flexible. Two sides of the frame have plastic pegs which insert into the holes on the other two sides of the frame so you can attach as many mats as you need to cover areas small or large. The flowers extend over the edge of the mat so the grid is pretty well hidden. The mat is so flexible that you can actually attach the mat to itself, creating a circular floral vase! The grids are an inch square which makes it super easy to work with for attaching the frame to another surface. We'd recommend floral wire or wire ties as an extra measure for keeping them secured. Create breath-taking wedding and event decor by attaching to a trellis or Arch. Fashion a stunning wall of flowers behind a head table which can double as an elegant photo backdrop. Use to mask or enhance a column, wall or door and accent with a colorful rose monogram or logo to mark the occasion! If you want to create a design with other materials you can easily part the flowers and use the grid to attach items. If hanging from a wall or fence, use the grids to intertwine fairy string lights or create dimension with your flower wall by adding beautiful Draping Blossoms. This mat is an ideal size to use on drop ceilings with metal grids. Create a dreamy floral canopy by suspending the mat with magnet hooks, crystal or pearl strands. Hang Sparkling Crystal Ornaments for added glam. If you need a wall that will be seen from both sides, use the easily accessible grids and tie 2 mats back-to-back. You can even cut the plastic grid frame to make creative shapes. Many, many ways to use this Floral Wall Mat to make your dream garden a reality! TO AVOID THE LOOK OF "SEAMS" ON A FLOWER WALL USING A PIPE AND DRAPE STRUCTURE: The most critical point is to make sure that each wall panel is secured in multiple spots, not only to the pipes but to each adjoining panel as well. The tie should be a material that won't relax or stretch like burlap twine, wire ties or zip ties. When displaying multiple panels next to each other, each wall needs to be pulled taut so the seams don't show. The flowers extend over the frame, hiding the pipes while creating a seamless look. Another key is to secure each panel to the pipe AND to the adjoining panel in at least 3 spots. You can also connect the panels by using the pegs & holes on the sides of the plastic frame. Additionally, running picture wire horizontally, vertically and diagonally on the pipe and drape structure before adding the walls allows for a firmer background to support the walls. Please view our instructional video.]]>silkflowers gaandst wedding-decor using-flower-walls-wedding-event-backdropswild-pageblackdecor11https://s.yimg.com/aah/shopwildthings/flower-wall-19-1-2-x-27-premium-silk-roses-peonies-hydrangeas-matte-black-13.jpghttps://s.yimg.com/aah/shopwildthings/flower-wall-19-1-2-x-27-premium-silk-roses-peonies-hydrangeas-matte-black-14.jpg Create your own floral paradise with this super full, Premium Quality Silk Rose, Peony & Hydrangea Flower Wall with matte black flowers that absolutely burst from this floral mat! Black is classy and goes with absolutely every color! *The flexible plastic frame is 15 1/2" by 23" but the flowers extend over the edges making the actual measurement about 19 1/2" by 27" and it ranges from 2 1/2" to 3" deep! This wall is chocked full of a luscious mix of all black flowers with pops of green leaves here and there. The roses are 4" in diameter, the peonies are 3 1/2" in diameter and the hydrangeas are 2 1/2" in diameter. This superb mix of flowers in varying textures is stunning and glamorous and you cannot see the plastic frame through this dense wall! These are so full that they can be wrapped around columns, gazebos and more! This mat only weighs 1.4 lbs. which allows for many display possibilities. The flowers are attached to a sturdy, plastic grid frame that is completely flexible. Two sides of the frame have plastic pegs which insert into the holes on the other two sides of the frame so you can attach as many mats as you need to cover areas small or large. The flowers extend over the edge of the mat so the grid is pretty well hidden. The mat is so flexible that you can actually attach the mat to itself, creating a circular floral vase! The grids are an inch square which makes it super easy to work with for attaching the frame to another surface. We'd recommend floral wire or wire ties as an extra measure for keeping them secure or simply staple-gun it to a solid surface. Create breath-taking wedding and event decor by attaching to a trellis, plywood or heavy wire structure. Fashion a stunning wall of flowers as a backdrop behind a head table which can double as an elegant photo backdrop. Use to mask or enhance a column, wall or door and easily add Fairy String Lights to add even more dimension. This mat is an ideal size to use on drop ceilings with metal grids. Create a dreamy floral canopy by suspending the mat with magnet hooks. Intertwine Sparkling Crystal Strands for added glam or add playful butterfly garlands! If you need a wall that will be seen from both sides, use the easily accessible grids and tie 2 mats back-to-back. You can even cut the plastic grid frame to make creative shapes. Many, many ways to use this Floral Wall Mat to make your dream garden a reality! TO AVOID THE LOOK OF "SEAMS" ON A FLOWER WALL USING A PIPE AND DRAPE STRUCTURE: The most critical point is to make sure that each wall panel is secured in multiple spots, not only to the pipes but to each adjoining panel as well. The tie should be a material that won't relax or stretch like burlap twine, wire ties or zip ties. When displaying multiple panels next to each other, each wall needs to be pulled taut so the seams don't show. The flowers extend over the frame, hiding the pipes while creating a seamless look. Another key is to secure each panel to the pipe AND to the adjoining panel in at least 3 spots. You can also connect the panels by using the pegs & holes on the sides of the plastic frame. Additionally, running picture wire horizontally, vertically and diagonally on the pipe and drape structure before adding the walls allows for a firmer background to support the walls. Please view our Instructional Video on how to build a flower wall.]]>floral-walls-greenery-backdrops artificialgreenery silkflowers using-flower-walls-wedding-event-backdropswild-pagefloral-walls-greenery-backdrops1https://s.yimg.com/aah/shopwildthings/flower-wall-19-x-27-silk-roses-hydrangeas-blush-pink-ivory-38.jpghttps://s.yimg.com/aah/shopwildthings/flower-wall-19-x-27-silk-roses-hydrangeas-blush-pink-ivory-39.jpg*The frame is 15 3/4" by 23" but the flowers extend over the edges making the actual measurement about 19" x 25 1/2" and it ranges from 2" to 3" deep! This wall is chocked full of a luscious mix of glorious Soft Pink Roses that are 4" in diameter and splendid Ivory Hydrangeas that are approx. 2" in diameter. The roses are cupped into green leaves, giving a nice contrast and added texture. This mat only weighs about 1 lb. 6 oz. which allows for many display possibilities. The flowers are attached to a sturdy, plastic grid frame that is completely flexible. Two sides of the frame have plastic pegs which insert into the holes on the other two sides of the frame so you can attach as many mats as you need to cover areas small or large. The flowers extend over the edge of the mat so the grid is pretty well hidden. The mat is so flexible that you can actually attach the mat to itself, creating a circular floral vase! The grids are an inch square which makes it super easy to work with for attaching the frame to another surface. We'd recommend floral wire or wire ties as an extra measure for keeping them secure or simply staple-gun it to a solid surface. Create breath-taking wedding and event decor by attaching to a trellis, gazebo or pavilion. Fashion a stunning wall of flowers and Landscape Wall Greenery behind a head table which can double as an elegant photo backdrop. Use to mask or enhance a column, wall or door and accent with a colorful rose monogram or logo to mark the occasion! If you want to create a design with other materials you can easily part the flowers and use the grid to attach items. Intertwine fairy string lights or create dimension with your flower wall by intertwining a Crystal Beaded Flower Garlands! This mat is an ideal size to use on drop ceilings with metal grids. Create a dreamy floral canopy by suspending the mat with magnet hooks, crystal or pearl strands. Add Sparkling Crystal Strands for added glam. If you need a wall that will be seen from both sides, use the easily accessible grids and tie 2 mats back-to-back. You can even cut the plastic grid frame to make creative shapes. Many, many ways to use this Floral Wall Mat to make your dream garden a reality! TO AVOID THE LOOK OF "SEAMS" ON A FLOWER WALL USING A PIPE AND DRAPE STRUCTURE: The most critical point is to make sure that each wall panel is secured in multiple spots, not only to the pipes but to each adjoining panel as well. The tie should be a material that won't relax or stretch like burlap twine, wire ties or zip ties. When displaying multiple panels next to each other, each wall needs to be pulled taut so the seams don't show. The flowers extend over the frame, hiding the pipes while creating a seamless look. Another key is to secure each panel to the pipe AND to the adjoining panel in at least 3 spots. You can also connect the panels by using the pegs & holes on the sides of the plastic frame. Additionally, running picture wire horizontally, vertically and diagonally on the pipe and drape structure before adding the walls allows for a firmer background to support the walls. Please view our instructional video.]]>artificialgreenery floral-walls-greenery-backdrops silkflowers effectively-using-spectacular-silk-flowerswild-pagepinks11https://s.yimg.com/aah/shopwildthings/blush-pink-artificial-rose-landscape-walls-13.jpghttps://s.yimg.com/aah/shopwildthings/blush-pink-artificial-rose-landscape-walls-14.jpg Create your own floral paradise with our durable, bendable Pink Silk Rose and Leafy Green Flower Wall Mat and immerse yourself and your guests in tropical floral bliss! *The frame is 15 1/2" by 23" but the flowers extend over the edges making the actual measurement about 19" x 25". The majority of the roses are a luscious 3" – 4" wide by 3" deep with several younger rose sprigs popping up to approx. 4". The flowers sit above the dark green leaves, making this a very textured and dimensional wall, like an actual growing wall of roses! This mat only weighs 15 oz. which allows for many display possibilities. The flowers are attached to a sturdy, plastic grid frame that is completely flexible. Two sides of the frame have plastic pegs which insert into the holes on the other two sides of the frame so you can attach as many mats as you need to cover areas small or large. The flowers extend over the edge of the mat so the grid is pretty well hidden. The mat is so flexible that you can actually attach the mat to itself, creating a circular floral vase! The grids are an inch square which makes it super easy to work with for attaching the frame to another surface. We'd recommend floral wire or wire ties as an extra measure for keeping them secure or simply staple-gun it to a solid surface. Create breath-taking wedding and event decor by attaching to a trellis, plywood or heavy wire structure. Fashion a stunning wall of flowers as a backdrop behind a head table which can double as an elegant photo backdrop. Use to mask or enhance a column, wall or door and easily add Fairy String Lights to add even more dimension. This mat is an ideal size to use on drop ceilings with metal grids. Attach to "Victory", our portable flower wall frame stands which can sit on tables or remove the legs to mount them on a wall. Create a dreamy floral canopy by suspending the mat with magnet hooks. Intertwine Sparkling Crystal Strands for added glam or add playful butterfly garlands! If you need a wall that will be seen from both sides, use the easily accessible grids and tie 2 mats back-to-back. You can even cut the plastic grid frame to make creative shapes. Many, many ways to use this Floral Wall Mat to make your dream garden a reality! TO AVOID THE LOOK OF "SEAMS" ON A FLOWER WALL USING A PIPE AND DRAPE STRUCTURE: The most critical point is to make sure that each wall panel is secured in multiple spots, not only to the pipes but to each adjoining panel as well. The tie should be a material that won't relax or stretch like burlap twine, wire ties or zip ties. When displaying multiple panels next to each other, each wall needs to be pulled taut so the seams don't show. The flowers extend over the frame, hiding the pipes while creating a seamless look. Another key is to secure each panel to the pipe AND to the adjoining panel in at least 3 spots. You can also connect the panels by using the pegs & holes on the sides of the plastic frame. Additionally, running picture wire horizontally, vertically and diagonally on the pipe and drape structure before adding the walls allows for a firmer background to support the walls. Please view our Instructional Video on how to build a flower wall.]]>floral-walls-greenery-backdrops artificialgreenery silkflowers using-flower-walls-wedding-event-backdropswild-pagebrandnewitems1https://s.yimg.com/aah/shopwildthings/artificial-flower-wall-backdrop-coral-pink-27.jpghttps://s.yimg.com/aah/shopwildthings/artificial-flower-wall-backdrop-coral-pink-28.jpgEXTRA FULL! These are so full that they can be wrapped around columns, gazebos and more! Create your own floral paradise with our durable, bendable Premium Quality Silk Hydrangea Coral Pink Flower Wall Mat and immerse yourself and your guests in tropical floral bliss! *The flexible plastic frame is 15 1/2" by 23" but the flowers extend over the edges making the actual measurement about 19" x 26 1/2" and it's 2 1/2" deep. Chocked full of splendid Hydrangea flowers, each soft and luscious bloom is approx. 2 1/2" wide. This mat only weighs 14 oz. which allows for many display possibilities. The flowers are attached to a sturdy, plastic grid frame that is completely flexible. Two sides of the frame have plastic pegs which insert into the holes on the other two sides of the frame so you can attach as many mats as you need to cover areas small or large. The flowers are dense and extend over the edge of the mat so the grid is hidden. The mat is so flexible that you can actually attach the mat to itself, creating a circular floral vase! The grids are an inch square which makes it super easy to work with for attaching the frame to another surface. We'd recommend floral wire or wire ties as an extra measure for keeping them secure or simply staple-gun it to a solid surface. Create breath-taking wedding and event Decor by attaching to a trellis, gazebo or pavilion. Fashion a stunning wall of flowers with a border of Landscape Wall Greenery behind a head table which can then double as an elegant photo backdrop. Use to mask or enhance a column, wall or door and accent with white artificial roses to create a monogram or logo to mark the occasion! This wall creates a focal point all by itself but you could also add lights by intertwining fairy string lights or add exotic Butterfly Garlands. This mat is an ideal size to use on drop ceilings with metal grids. Create a dreamy floral canopy by suspending the mat with magnet hooks, crystal or pearl strands. Hang Sparkling Crystal Pendants & Ornaments for added glam. If you need a wall that will be seen from both sides, use the easily accessible grids and tie 2 mats back-to-back. You can even cut the plastic grid frame to make creative shapes. Many, many ways to use this Floral Wall Mat to make your dream garden a reality! TO AVOID THE LOOK OF "SEAMS" ON A FLOWER WALL USING A PIPE AND DRAPE STRUCTURE: The most critical point is to make sure that each wall panel is secured in multiple spots, not only to the pipes but to each adjoining panel as well. The tie should be a material that won't relax or stretch like burlap twine, wire ties or zip ties. When displaying multiple panels next to each other, each wall needs to be pulled taut so the seams don't show. The flowers extend over the frame, hiding the pipes while creating a seamless look. Another key is to secure each panel to the pipe AND to the adjoining panel in at least 3 spots. You can also connect the panels by using the pegs & holes on the sides of the plastic frame. Additionally, running picture wire horizontally, vertically and diagonally on the pipe and drape structure before adding the walls allows for a firmer background to support the walls. Please view our instructional video.]]>floral-walls-greenery-backdrops artificialgreenery silkflowers using-flower-walls-wedding-event-backdropswild-pagewhclde11https://s.yimg.com/aah/shopwildthings/roses-and-leaves-flower-wall-ivory-cream-31.jpghttps://s.yimg.com/aah/shopwildthings/roses-and-leaves-flower-wall-ivory-cream-32.jpg Create your own floral paradise with our durable, bendable Cream Silk Rose and Leafy Green Flower Wall Mat and immerse yourself and your guests in tropical floral bliss! *The frame is 15 1/2" by 23" but the flowers extend over the edges making the actual measurement about 19" x 26". The majority of the roses are a luscious 3" – 4" wide by 3" deep with several younger rose sprigs popping up to approx. 4". The flowers sit above the dark green leaves, making this a very textured and dimensional wall, like an actual growing wall of roses! This mat only weighs 15 oz. which allows for many display possibilities. The flowers are attached to a sturdy, plastic grid frame that is completely flexible. Two sides of the frame have plastic pegs which insert into the holes on the other two sides of the frame so you can attach as many mats as you need to cover areas small or large. The flowers extend over the edge of the mat so the grid is pretty well hidden. The mat is so flexible that you can actually attach the mat to itself, creating a circular floral vase! The grids are an inch square which makes it super easy to work with for attaching the frame to another surface. We'd recommend floral wire or wire ties as an extra measure for keeping them secure or simply staple-gun it to a solid surface. Create breath-taking wedding and event decor by attaching to a trellis, plywood or heavy wire structure. Fashion a stunning wall of flowers as a backdrop behind a head table which can double as an elegant photo backdrop. Use to mask or enhance a column, wall or door and easily add Fairy String Lights to add even more dimension. This mat is an ideal size to use on drop ceilings with metal grids. Create a dreamy floral canopy by suspending the mat with magnet hooks. Intertwine Sparkling Crystal Strands for added glam or add playful butterfly garlands! If you need a wall that will be seen from both sides, use the easily accessible grids and tie 2 mats back-to-back. You can even cut the plastic grid frame to make creative shapes. Many, many ways to use this Floral Wall Mat to make your dream garden a reality! TO AVOID THE LOOK OF "SEAMS" ON A FLOWER WALL USING A PIPE AND DRAPE STRUCTURE: The most critical point is to make sure that each wall panel is secured in multiple spots, not only to the pipes but to each adjoining panel as well. The tie should be a material that won't relax or stretch like burlap twine, wire ties or zip ties. When displaying multiple panels next to each other, each wall needs to be pulled taut so the seams don't show. The flowers extend over the frame, hiding the pipes while creating a seamless look. Another key is to secure each panel to the pipe AND to the adjoining panel in at least 3 spots. You can also connect the panels by using the pegs & holes on the sides of the plastic frame. Additionally, running picture wire horizontally, vertically and diagonally on the pipe and drape structure before adding the walls allows for a firmer background to support the walls. Please view our Instructional Video on how to build a flower wall.]]>floral-walls-greenery-backdrops artificialgreenery silkflowers using-flower-walls-wedding-event-backdropswild-pagewhclde11https://s.yimg.com/aah/shopwildthings/greenery-backdrop-with-white-roses-13.jpghttps://s.yimg.com/aah/shopwildthings/greenery-backdrop-with-white-roses-14.jpg Create your own floral paradise with our durable, bendable White Silk Rose and Leafy Green Flower Wall Mat and immerse yourself and your guests in tropical floral bliss! *The frame is 15 1/2" by 23" but the flowers extend over the edges making the actual measurement about 19" x 26". The majority of the roses are a luscious 3" – 4" wide by 3" deep with several younger rose sprigs popping up to approx. 4". The flowers sit above the dark green leaves, making this a very textured and dimensional wall, like an actual growing wall of roses! This mat only weighs 15 oz. which allows for many display possibilities. The flowers are attached to a sturdy, plastic grid frame that is completely flexible. Two sides of the frame have plastic pegs which insert into the holes on the other two sides of the frame so you can attach as many mats as you need to cover areas small or large. The flowers extend over the edge of the mat so the grid is pretty well hidden. The mat is so flexible that you can actually attach the mat to itself, creating a circular floral vase! The grids are an inch square which makes it super easy to work with for attaching the frame to another surface. We'd recommend floral wire or wire ties as an extra measure for keeping them secure or simply staple-gun it to a solid surface. Create breath-taking wedding and event decor by attaching to a trellis, plywood or heavy wire structure. Fashion a stunning wall of flowers as a backdrop behind a head table which can double as an elegant photo backdrop. Use to mask or enhance a column, wall or door and easily add Fairy String Lights to add even more dimension. This mat is an ideal size to use on drop ceilings with metal grids. Create a dreamy floral canopy by suspending the mat with magnet hooks. Intertwine Sparkling Crystal Strands for added glam or add playful butterfly garlands! If you need a wall that will be seen from both sides, use the easily accessible grids and tie 2 mats back-to-back. You can even cut the plastic grid frame to make creative shapes. Many, many ways to use this Floral Wall Mat to make your dream garden a reality! TO AVOID THE LOOK OF "SEAMS" ON A FLOWER WALL USING A PIPE AND DRAPE STRUCTURE: The most critical point is to make sure that each wall panel is secured in multiple spots, not only to the pipes but to each adjoining panel as well. The tie should be a material that won't relax or stretch like burlap twine, wire ties or zip ties. When displaying multiple panels next to each other, each wall needs to be pulled taut so the seams don't show. The flowers extend over the frame, hiding the pipes while creating a seamless look. Another key is to secure each panel to the pipe AND to the adjoining panel in at least 3 spots. You can also connect the panels by using the pegs & holes on the sides of the plastic frame. Additionally, running picture wire horizontally, vertically and diagonally on the pipe and drape structure before adding the walls allows for a firmer background to support the walls. Please view our Instructional Video on how to build a flower wall.]]>floral-walls-greenery-backdrops artificialgreenery silkflowers using-flower-walls-wedding-event-backdropswild-pagepurplestuff11https://s.yimg.com/aah/shopwildthings/flower-wall-19-x-27-premium-silk-roses-hydrangeas-purple-35.jpghttps://s.yimg.com/aah/shopwildthings/flower-wall-19-x-27-premium-silk-roses-hydrangeas-purple-36.jpg Ever dream of walking into a flower garden that literally engulfs you in gorgeous flowers? Now you can create your own floral paradise with our durable, bendable Purple Silk Flower Rose and Hydrangea Mix Wall Mat and immerse yourself and your guests in tropical floral bliss! *The frame is 15 1/2" by 23" but the flowers extend over the edges making the actual measurement about 19" x 27" and it ranges from 2 1/2" to 3" deep! This wall is chocked full of a luscious mix of beautiful purple roses that are 4" in diameter and splendid purple hydrangeas that are approx. 2" in diameter with white seeds. The roses are cupped into green leaves, giving a nice contrast and added texture. This mat only weighs about 1 lb. 6 oz. which allows for many display possibilities. The flowers are attached to a sturdy, plastic grid frame that is completely flexible. Two sides of the frame have plastic pegs which insert into the holes on the other two sides of the frame so you can attach as many mats as you need to cover areas small or large. The flowers extend over the edge of the mat so the grid is completely hidden. The mat is so flexible that you can actually attach the mat to itself, creating a circular floral vase! The grids are an inch square which makes it super easy to work with for attaching the frame to another surface. Attach to "Victory", our portable flower wall frame stands which can sit on tables or, remove the legs to mount them on a wall. We'd recommend floral wire or wire ties as an extra measure for keeping them secure or simply staple-gun it to a solid surface. Create breath-taking wedding and event decor by attaching to a trellis, gazebo or pavilion. Fashion a stunning wall of flowers outlined with Assorted Greenery behind a head table which can double as an elegant photo backdrop. Use to mask or enhance a column, wall or door and accent with a colorful rose monogram or logo to mark the occasion! If you want to create a design with other materials you can easily part the flowers and use the grid to attach items. Intertwine fairy string lights and this mat is an ideal size to use on drop ceilings with metal grids. Create a dreamy floral canopy by suspending the mat with magnet hooks, crystal or pearl strands. Intertwine Sparkling Crystal Strands for added glam. If you need a wall that will be seen from both sides, use the easily accessible grids and tie 2 mats back-to-back. You can even cut the plastic grid frame to make creative shapes. Many, many ways to use this Floral Wall Mat to make your dream garden a reality! TO AVOID THE LOOK OF "SEAMS" ON A FLOWER WALL USING A PIPE AND DRAPE STRUCTURE: The most critical point is to make sure that each wall panel is secured in multiple spots, not only to the pipes but to each adjoining panel as well. The tie should be a material that won't relax or stretch like burlap twine, wire ties or zip ties. When displaying multiple panels next to each other, each wall needs to be pulled taut so the seams don't show. The flowers extend over the frame, hiding the pipes while creating a seamless look. Another key is to secure each panel to the pipe AND to the adjoining panel in at least 3 spots. You can also connect the panels by using the pegs & holes on the sides of the plastic frame. Additionally, running picture wire horizontally, vertically and diagonally on the pipe and drape structure before adding the walls allows for a firmer background to support the walls. Please view our instructional video.]]>artificialgreenery floral-walls-greenery-backdrops silkflowers effectively-using-spectacular-silk-flowerswild-page11https://s.yimg.com/aah/shopwildthings/flower-wall-backdrop-stand-tutorial-victory-white-metal-frame-set-of-4-15.jpghttps://s.yimg.com/aah/shopwildthings/flower-wall-backdrop-stand-tutorial-victory-white-metal-frame-set-of-4-16.jpgIt can be tough to figure out what to hang your Flower Wall Panels and Greenery Landscape Walls on in order to display them for your weddings and events. In this video, we answer the questions you have about how to use our new "Victory" White Metal Backdrop Stand and different ideas on how to place them. freestanding-flower-wall-frame-metal-setof4 floral-walls-greenery-backdrops artificialgreenerywild-pageflowerwallkits11Professional Grade Pipe & Drape Backdrop to create a stand-alone wall of flowers! Optionally, add valance hangers and a 2nd crossbar to the backdrop to hang sheers in front to frame the wall. The 2nd crossbar also creates a space to hold flower garlands and flowering tree branches. With or without the pipe and drape hardware, this flower kit offers all the options you need to create the dramatic flair that will send your event over the top! This Flower Wall Kit contains:

  • 24 Pcs Premium Silk Matte Black Flower Walls that are super full with 4" wide roses, 3 1/2" wide peonies & 2 1/2" wide hydrangeas
  • 64 Square feet of Extra Strength Polypropylene Fencing, lightweight but incredibly tough
  • 100 Zip Ties (wire ties), each 8" long, to secure the walls to the fencing and optionally to secure the wall to a pipe and drape backdrop

  • The long side of the flower wall is 27" and the shorter side is 19.5". Depending on how you place the walls, you can have 6 rows, 4 walls per row or 4 rows, 6 walls per row. We provide enough walls so that the overhang of the flowers will conceal the fencing. Do a little fluffing and you're set! Optionally add string lights, signs, monograms & logos. Since the back of the flower walls and the fencing are a grid, there are tons of attachment points for extra goodies. One huge advantage of using the pipe & drape backdrop is that it is much easier to assemble the wall once the fencing has been attached to the pipes. Another advantage is that it's easy to swap out the look you’re after. If you have a flower wall kit and need a different color or say you want greenery, just clip the wire ties that hold the entire wall to the backdrop pipes and swap in a different kit! ]]>
    flowerwallkits pipe-and-drape-backdrops silkflowers
    wild-pageflowerwallkits11Professional Grade Pipe & Drape Backdrop to create a stand-alone wall of flowers! Optionally, add valance hangers and a 2nd crossbar to the backdrop to hang sheers in front to frame the wall. The 2nd crossbar also creates a space to hold flower garlands and flowering tree branches. With or without the pipe and drape hardware, this flower kit offers all the options you need to create the dramatic flair that will send your event over the top! This Flower Wall Kit contains:
  • 24 Pcs Blush Pink Cherry Blossom Flower Walls with 2" wide flowers
  • 64 Square feet of Extra Strength Polypropylene Fencing, lightweight but incredibly tough
  • 100 Zip Ties (wire ties), each 8" long, to secure the walls to the fencing and optionally to secure the wall to a pipe and drape backdrop

  • The long side of the flower wall is 25" and the shorter side is 17". Depending on how you place the walls, you can have 6 rows, 4 walls per row or 4 rows, 6 walls per row. We provide enough walls so that the overhang of the flowers will conceal the fencing. Do a little fluffing and you're set! Optionally add string lights, signs, monograms & logos. Since the back of the flower walls and the fencing are a grid, there are tons of attachment points for extra goodies. One huge advantage of using the pipe & drape backdrop is that it is much easier to assemble the wall once the fencing has been attached to the pipes. Another advantage is that it's easy to swap out the look you’re after. If you have a flower wall kit and need a different color or say you want greenery, just clip the wire ties that hold the entire wall to the backdrop pipes and swap in a different kit! ]]>
    flowerwallkits pipe-and-drape-backdrops silkflowers
    wild-pageflowerwallkits11Professional Grade Pipe & Drape Backdrop to create a stand-alone wall of flowers! Optionally, add valance hangers and a 2nd crossbar to the backdrop to hang sheers in front to frame the wall. The 2nd crossbar also creates a space to hold flower garlands and flowering tree branches. With or without the pipe and drape hardware, this flower kit offers all the options you need to create the dramatic flair that will send your event over the top! This Flower Wall Kit contains:
  • 24 Pcs Blush Pink Hydrangea Flower Walls with 2" wide flowers
  • 64 Square feet of Extra Strength Polypropylene Fencing, lightweight but incredibly tough
  • 100 Zip Ties (wire ties), each 8" long, to secure the walls to the fencing and optionally to secure the wall to a pipe and drape backdrop

  • The long side of the flower wall is 25" and the shorter side is 17". Depending on how you place the walls, you can have 6 rows, 4 walls per row or 4 rows, 6 walls per row. We provide enough walls so that the overhang of the flowers will conceal the fencing. Do a little fluffing and you're set! Optionally add string lights, signs, monograms & logos. Since the back of the flower walls and the fencing are a grid, there are tons of attachment points for extra goodies. One huge advantage of using the pipe & drape backdrop is that it is much easier to assemble the wall once the fencing has been attached to the pipes. Another advantage is that it's easy to swap out the look you’re after. If you have a flower wall kit and need a different color or say you want greenery, just clip the wire ties that hold the entire wall to the backdrop pipes and swap in a different kit! ]]>
    flowerwallkits pipe-and-drape-backdrops silkflowers
    wild-pagefloral-walls-greenery-backdrops11https://s.yimg.com/aah/shopwildthings/flower-wall-kit-8-x-8-portable-backdrop-kit-blush-pink-roses-hydrangeas-72.jpghttps://s.yimg.com/aah/shopwildthings/flower-wall-kit-8-x-8-portable-backdrop-kit-blush-pink-roses-hydrangeas-73.jpgProfessional Grade Pipe & Drape Backdrop to create a stand-alone wall of flowers! Optionally, add valance hangers and a 2nd crossbar to the backdrop to hang sheers in front to frame the wall. The 2nd crossbar also creates a space to hold flower garlands and flowering tree branches. With or without the pipe and drape hardware, this flower kit offers all the options you need to create the dramatic flair that will send your event over the top! This Flower Wall Kit features our Premium Blush Pink Silk Roses & Hydrangeas Flower Wall and contains:
  • 24 Pcs Blush Pink Roses & Hydrangea Flower Walls that are super full with large roses
  • 64 Square feet of Extra Strength Polypropylene Fencing, lightweight but incredibly tough
  • 100 Zip Ties (wire ties), each 8" long, to secure the walls to the fencing and optionally to secure the wall to a pipe and drape backdrop

  • The long side of the flower wall frame is 23" and should be placed horizontally along the fencing. Four walls will make 1 row. The overhang of the flowers will conceal the fencing. We placed 2 rows across the top, 3 rows coming up from the bottom, then cut 2 walls to fill in the mid-section. Do a little fluffing and you're set! Optionally add string lights, signs & logos or use artificial flower blooms to accentuate as you desire. Since the back of the flower walls and the fencing are a grid, there are tons of attachment points for extra goodies. One huge advantage of using the pipe & drape backdrop is that it is much easier to assemble the wall once the fencing has been attached to the pipes. Another advantage is that it's easy to swap out the look you’re after. If you have a flower wall kit and need a different color or say you want greenery, just clip the wire ties that hold the entire wall to the backdrop pipes and swap in a different kit! ]]>
    flowerwallkits pipe-and-drape-backdrops wearisma
    wild-page11Professional Grade Pipe & Drape Backdrop to create a stand-alone wall of flowers! Optionally, add valance hangers and a 2nd crossbar to the backdrop to hang sheers in front to frame the wall. The 2nd crossbar also creates a space to hold flower garlands and flowering tree branches. With or without the pipe and drape hardware, this flower kit offers all the options you need to create the dramatic flair that will send your event over the top! This Flower Wall Kit contains:
  • 24 Pcs Blush Pink Hydrangea Flower Walls with 4" wide roses and 2" wide hydrangea flowers
  • 64 Square feet of Extra Strength Polypropylene Fencing, lightweight but incredibly tough
  • 100 Zip Ties (wire ties), each 8" long, to secure the walls to the fencing and optionally to secure the wall to a pipe and drape backdrop

  • The long side of the flower wall is 24" and the shorter side is 16.5". Depending on how you place the walls, you can have 6 rows, 4 walls per row or 4 rows, 6 walls per row. We provide enough walls so that the overhang of the flowers will conceal the fencing. Do a little fluffing and you're set! Optionally add string lights, signs, monograms & logos. Since the back of the flower walls and the fencing are a grid, there are tons of attachment points for extra goodies. One huge advantage of using the pipe & drape backdrop is that it is much easier to assemble the wall once the fencing has been attached to the pipes. Another advantage is that it's easy to swap out the look you’re after. If you have a flower wall kit and need a different color or say you want greenery, just clip the wire ties that hold the entire wall to the backdrop pipes and swap in a different kit! ]]>
    flowerwallkits pipe-and-drape-backdrops silkflowers
    wild-page1Professional Grade Pipe & Drape Backdrop to create a stand-alone wall of flowers! Optionally, add valance hangers and a 2nd crossbar to the backdrop to hang sheers in front to frame the wall. The 2nd crossbar also creates a space to hold flower garlands and flowering tree branches. With or without the pipe and drape hardware, this flower kit offers all the options you need to create the dramatic flair that will send your event over the top! This Flower Wall Kit contains:
  • 24 Pcs Flower Walls with 3.5" to 6" wide mix of roses, peonies & plumeria in red, pinks, peach & cream
  • 64 Square feet of Extra Strength Polypropylene Fencing, lightweight but incredibly tough
  • 100 Zip Ties (wire ties), each 8" long, to secure the walls to the fencing and optionally to secure the wall to a pipe and drape backdrop

  • The long side of the flower wall is 25" and the shorter side is 18". Depending on how you place the walls, you can have 6 rows, 4 walls per row or 4 rows, 6 walls per row. We provide enough walls so that the overhang of the flowers will conceal the fencing. Do a little fluffing and you're set! Optionally add string lights, signs, monograms & logos. Since the back of the flower walls and the fencing are a grid, there are tons of attachment points for extra goodies. One huge advantage of using the pipe & drape backdrop is that it is much easier to assemble the wall once the fencing has been attached to the pipes. Another advantage is that it's easy to swap out the look you’re after. If you have a flower wall kit and need a different color or say you want greenery, just clip the wire ties that hold the entire wall to the backdrop pipes and swap in a different kit!]]>
    flowerwallkits pipe-and-drape-backdrops silkflowers
    wild-pageflowerwallkits11Professional Grade Pipe & Drape Backdrop to create a stand-alone wall of flowers! Optionally, add valance hangers and a 2nd crossbar to the backdrop to hang sheers in front to frame the wall. The 2nd crossbar also creates a space to hold flower garlands and flowering tree branches. With or without the pipe and drape hardware, this flower kit offers all the options you need to create the dramatic flair that will send your event over the top! This Flower Wall Kit contains:
  • 24 Pcs Cream & White Cherry Blossom Flower Walls with 2" wide flowers
  • 64 Square feet of Extra Strength Polypropylene Fencing, lightweight but incredibly tough
  • 100 Zip Ties (wire ties), each 8" long, to secure the walls to the fencing and optionally to secure the wall to a pipe and drape backdrop

  • The long side of the flower wall is 25" and the shorter side is 17". Depending on how you place the walls, you can have 6 rows, 4 walls per row or 4 rows, 6 walls per row. We provide enough walls so that the overhang of the flowers will conceal the fencing. Do a little fluffing and you're set! Optionally add string lights, signs, monograms & logos. Since the back of the flower walls and the fencing are a grid, there are tons of attachment points for extra goodies. One huge advantage of using the pipe & drape backdrop is that it is much easier to assemble the wall once the fencing has been attached to the pipes. Another advantage is that it's easy to swap out the look you’re after. If you have a flower wall kit and need a different color or say you want greenery, just clip the wire ties that hold the entire wall to the backdrop pipes and swap in a different kit! ]]>
    flowerwallkits pipe-and-drape-backdrops silkflowers
    wild-page1Professional Grade Pipe & Drape Backdrop to create a stand-alone wall of flowers! Optionally, add valance hangers and a 2nd crossbar to the backdrop to hang sheers in front to frame the wall. The 2nd crossbar also creates a space to hold flower garlands and flowering tree branches. With or without the pipe and drape hardware, this flower kit offers all the options you need to create the dramatic flair that will send your event over the top! This Flower Wall Kit contains:
  • 24 Pcs Cream Roses and Hydrangea Flower Walls with 4" wide roses and 2" wide hydrangea
  • 64 Square feet of Extra Strength Polypropylene Fencing, lightweight but incredibly tough
  • 100 Zip Ties (wire ties), each 8" long, to secure the walls to the fencing and optionally to secure the wall to a pipe and drape backdrop

  • The long side of the flower wall is 25.5" and the shorter side is 19". Depending on how you place the walls, you can have 6 rows, 4 walls per row or 4 rows, 6 walls per row. We provide enough walls so that the overhang of the flowers will conceal the fencing. Do a little fluffing and you're set! Optionally add string lights, signs, monograms & logos. Since the back of the flower walls and the fencing are a grid, there are tons of attachment points for extra goodies. One huge advantage of using the pipe & drape backdrop is that it is much easier to assemble the wall once the fencing has been attached to the pipes. Another advantage is that it's easy to swap out the look you’re after. If you have a flower wall kit and need a different color or say you want greenery, just clip the wire ties that hold the entire wall to the backdrop pipes and swap in a different kit!]]>
    flowerwallkits pipe-and-drape-backdrops silkflowers
    wild-pageflowerwallkits11Professional Grade Pipe & Drape Backdrop to create a stand-alone wall of flowers! Optionally, add valance hangers and a 2nd crossbar to the backdrop to hang sheers in front to frame the wall. The 2nd crossbar also creates a space to hold flower garlands and flowering tree branches. With or without the pipe and drape hardware, this flower kit offers all the options you need to create the dramatic flair that will send your event over the top! This Flower Wall Kit contains:
  • 24 Pcs Premium Cream Silk Roses & Green Leaves Flower Walls that are super full with large roses
  • 64 Square feet of Extra Strength Polypropylene Fencing, lightweight but incredibly tough
  • 100 Zip Ties (wire ties), each 8" long, to secure the walls to the fencing and optionally to secure the wall to a pipe and drape backdrop

  • The long side of the flower wall is 26" and the shorter side is 19". Depending on how you place the walls, you can have 6 rows, 4 walls per row or 4 rows, 6 walls per row. We provide enough walls so that the overhang of the flowers will conceal the fencing. Do a little fluffing and you're set! Optionally add string lights, signs & logos or use artificial flower blooms to accentuate as you desire. Since the back of the flower walls and the fencing are a grid, there are tons of attachment points for extra goodies. One huge advantage of using the pipe & drape backdrop is that it is much easier to assemble the wall once the fencing has been attached to the pipes. Another advantage is that it's easy to swap out the look you’re after. If you have a flower wall kit and need a different color or say you want greenery, just clip the wire ties that hold the entire wall to the backdrop pipes and swap in a different kit! ]]>
    flowerwallkits pipe-and-drape-backdrops silkflowers
    wild-page1Professional Grade Pipe & Drape Backdrop to create a stand-alone wall of flowers! Optionally, add valance hangers and a 2nd crossbar to the backdrop to hang sheers in front to frame the wall. The 2nd crossbar also creates a space to hold flower garlands and flowering tree branches. With or without the pipe and drape hardware, this flower kit offers all the options you need to create the dramatic flair that will send your event over the top! This Flower Wall Kit contains:
  • 24 Pcs Cream Roses, Peonies and Hydrangea Flower Walls with 4" wide roses, 3.5" wide peonies and 2.5" wide hydrangea
  • 64 Square feet of Extra Strength Polypropylene Fencing, lightweight but incredibly tough
  • 100 Zip Ties (wire ties), each 8" long, to secure the walls to the fencing and optionally to secure the wall to a pipe and drape backdrop

  • The long side of the flower wall is 27" and the shorter side is 19.5". Depending on how you place the walls, you can have 6 rows, 4 walls per row or 4 rows, 6 walls per row. We provide enough walls so that the overhang of the flowers will conceal the fencing. Do a little fluffing and you're set! Optionally add string lights, signs, monograms & logos. Since the back of the flower walls and the fencing are a grid, there are tons of attachment points for extra goodies. One huge advantage of using the pipe & drape backdrop is that it is much easier to assemble the wall once the fencing has been attached to the pipes. Another advantage is that it's easy to swap out the look you’re after. If you have a flower wall kit and need a different color or say you want greenery, just clip the wire ties that hold the entire wall to the backdrop pipes and swap in a different kit!]]>
    flowerwallkits pipe-and-drape-backdrops silkflowers
    wild-pageflowerwallkits11Professional Grade Pipe & Drape Backdrop to create a stand-alone wall of flowers! Optionally, add valance hangers and a 2nd crossbar to the backdrop to hang sheers in front to frame the wall. The 2nd crossbar also creates a space to hold flower garlands and flowering tree branches. With or without the pipe and drape hardware, this flower kit offers all the options you need to create the dramatic flair that will send your event over the top! This Flower Wall Kit contains:
  • 24 Pcs Green Hydrangea Flower Walls with 2" wide hydrangea flowers
  • 64 Square feet of Extra Strength Polypropylene Fencing, lightweight but incredibly tough
  • 100 Zip Ties (wire ties), each 8" long, to secure the walls to the fencing and optionally to secure the wall to a pipe and drape backdrop

  • The long side of the flower wall is 25" and the shorter side is 17". Depending on how you place the walls, you can have 6 rows, 4 walls per row or 4 rows, 6 walls per row. We provide enough walls so that the overhang of the flowers will conceal the fencing. Do a little fluffing and you're set! Optionally add string lights, signs, monograms & logos. Since the back of the flower walls and the fencing are a grid, there are tons of attachment points for extra goodies. One huge advantage of using the pipe & drape backdrop is that it is much easier to assemble the wall once the fencing has been attached to the pipes. Another advantage is that it's easy to swap out the look you’re after. If you have a flower wall kit and need a different color or say you want greenery, just clip the wire ties that hold the entire wall to the backdrop pipes and swap in a different kit! ]]>
    flowerwallkits pipe-and-drape-backdrops silkflowers
    wild-pageflowerwallkits11Professional Grade Pipe & Drape Backdrop to create a stand-alone wall of flowers! Optionally, add valance hangers and a 2nd crossbar to the backdrop to hang sheers in front to frame the wall. The 2nd crossbar also creates a space to hold flower garlands and flowering tree branches. With or without the pipe and drape hardware, this flower kit offers all the options you need to create the dramatic flair that will send your event over the top! This Flower Wall Kit contains:
  • 24 Pcs Ivory Hydrangea Flower Walls with 2" wide flowers
  • 64 Square feet of Extra Strength Polypropylene Fencing, lightweight but incredibly tough
  • 100 Zip Ties (wire ties), each 8" long, to secure the walls to the fencing and optionally to secure the wall to a pipe and drape backdrop

  • The long side of the flower wall is 25" and the shorter side is 17". Depending on how you place the walls, you can have 6 rows, 4 walls per row or 4 rows, 6 walls per row. We provide enough walls so that the overhang of the flowers will conceal the fencing. Do a little fluffing and you're set! Optionally add string lights, signs, monograms & logos. Since the back of the flower walls and the fencing are a grid, there are tons of attachment points for extra goodies. One huge advantage of using the pipe & drape backdrop is that it is much easier to assemble the wall once the fencing has been attached to the pipes. Another advantage is that it's easy to swap out the look you’re after. If you have a flower wall kit and need a different color or say you want greenery, just clip the wire ties that hold the entire wall to the backdrop pipes and swap in a different kit! ]]>
    flowerwallkits pipe-and-drape-backdrops silkflowers
    wild-pageflowerwallkits11Professional Grade Pipe & Drape Backdrop to create a stand-alone wall of flowers! Optionally, add valance hangers and a 2nd crossbar to the backdrop to hang sheers in front to frame the wall. The 2nd crossbar also creates a space to hold flower garlands and flowering tree branches. With or without the pipe and drape hardware, this flower kit offers all the options you need to create the dramatic flair that will send your event over the top! This Flower Wall Kit contains:
  • 24 Pcs Light Cream Hydrangea Flower Walls with soft and silky 2" wide flowers
  • 64 Square feet of Extra Strength Polypropylene Fencing, lightweight but incredibly tough
  • 100 Zip Ties (wire ties), each 8" long, to secure the walls to the fencing and optionally to secure the wall to a pipe and drape backdrop

  • The long side of the flower wall is 25" and the shorter side is 17". Depending on how you place the walls, you can have 6 rows, 4 walls per row or 4 rows, 6 walls per row. We provide enough walls so that the overhang of the flowers will conceal the fencing. Do a little fluffing and you're set! Optionally add string lights, signs, monograms & logos. Since the back of the flower walls and the fencing are a grid, there are tons of attachment points for extra goodies. One huge advantage of using the pipe & drape backdrop is that it is much easier to assemble the wall once the fencing has been attached to the pipes. Another advantage is that it's easy to swap out the look you’re after. If you have a flower wall kit and need a different color or say you want greenery, just clip the wire ties that hold the entire wall to the backdrop pipes and swap in a different kit! ]]>
    flowerwallkits pipe-and-drape-backdrops silkflowers
    wild-pageflowerwallkits11Professional Grade Pipe & Drape Backdrop to create a stand-alone wall of flowers! Optionally, add valance hangers and a 2nd crossbar to the backdrop to hang sheers in front to frame the wall. The 2nd crossbar also creates a space to hold flower garlands and flowering tree branches. With or without the pipe and drape hardware, this flower kit offers all the options you need to create the dramatic flair that will send your event over the top! This Flower Wall Kit contains:
  • 24 Pcs Metallic Gold Hydrangea Flower Walls with 2" wide flowers
  • 64 Square feet of Extra Strength Polypropylene Fencing, lightweight but incredibly tough
  • 100 Zip Ties (wire ties), each 8" long, to secure the walls to the fencing and optionally to secure the wall to a pipe and drape backdrop

  • The long side of the flower wall is 25" and the shorter side is 17". Depending on how you place the walls, you can have 6 rows, 4 walls per row or 4 rows, 6 walls per row. We provide enough walls so that the overhang of the flowers will conceal the fencing. Do a little fluffing and you're set! Optionally add string lights, signs, monograms & logos. Since the back of the flower walls and the fencing are a grid, there are tons of attachment points for extra goodies. One huge advantage of using the pipe & drape backdrop is that it is much easier to assemble the wall once the fencing has been attached to the pipes. Another advantage is that it's easy to swap out the look you’re after. If you have a flower wall kit and need a different color or say you want greenery, just clip the wire ties that hold the entire wall to the backdrop pipes and swap in a different kit! ]]>
    flowerwallkits pipe-and-drape-backdrops silkflowers
    wild-pageflowerwallkits11Professional Grade Pipe & Drape Backdrop to create a stand-alone wall of flowers! Optionally, add valance hangers and a 2nd crossbar to the backdrop to hang sheers in front to frame the wall. The 2nd crossbar also creates a space to hold flower garlands and flowering tree branches. With or without the pipe and drape hardware, this flower kit offers all the options you need to create the dramatic flair that will send your event over the top! This Flower Wall Kit contains:
  • 24 Pcs Metallic Silver Hydrangea Flower Walls with 2" wide flowers
  • 64 Square feet of Extra Strength Polypropylene Fencing, lightweight but incredibly tough
  • 100 Zip Ties (wire ties), each 8" long, to secure the walls to the fencing and optionally to secure the wall to a pipe and drape backdrop

  • The long side of the flower wall is 25" and the shorter side is 17". Depending on how you place the walls, you can have 6 rows, 4 walls per row or 4 rows, 6 walls per row. We provide enough walls so that the overhang of the flowers will conceal the fencing. Do a little fluffing and you're set! Optionally add string lights, signs, monograms & logos. Since the back of the flower walls and the fencing are a grid, there are tons of attachment points for extra goodies. One huge advantage of using the pipe & drape backdrop is that it is much easier to assemble the wall once the fencing has been attached to the pipes. Another advantage is that it's easy to swap out the look you’re after. If you have a flower wall kit and need a different color or say you want greenery, just clip the wire ties that hold the entire wall to the backdrop pipes and swap in a different kit! ]]>
    flowerwallkits pipe-and-drape-backdrops silkflowers
    wild-pageflowerwallkits11Professional Grade Pipe & Drape Backdrop to create a stand-alone wall of flowers! Optionally, add valance hangers and a 2nd crossbar to the backdrop to hang sheers in front to frame the wall. The 2nd crossbar also creates a space to hold flower garlands and flowering tree branches. With or without the pipe and drape hardware, this flower kit offers all the options you need to create the dramatic flair that will send your event over the top! This Flower Wall Kit contains:
  • 24 Pcs Off-White Silk Roses & Hydrangea Flower Walls that are super full with 4" wide roses and 2" wide hydrangeas
  • 64 Square feet of Extra Strength Polypropylene Fencing, lightweight but incredibly tough
  • 100 Zip Ties (wire ties), each 8" long, to secure the walls to the fencing and optionally to secure the wall to a pipe and drape backdrop

  • The long side of the flower wall is 24" and the shorter side is 16.5". Depending on how you place the walls, you can have 6 rows, 4 walls per row or 4 rows, 6 walls per row. We provide enough walls so that the overhang of the flowers will conceal the fencing. Do a little fluffing and you're set! Optionally add string lights, signs, monograms & logos. Since the back of the flower walls and the fencing are a grid, there are tons of attachment points for extra goodies. One huge advantage of using the pipe & drape backdrop is that it is much easier to assemble the wall once the fencing has been attached to the pipes. Another advantage is that it's easy to swap out the look you’re after. If you have a flower wall kit and need a different color or say you want greenery, just clip the wire ties that hold the entire wall to the backdrop pipes and swap in a different kit! ]]>
    flowerwallkits pipe-and-drape-backdrops silkflowers
    wild-pageflowerwallkits11Professional Grade Pipe & Drape Backdrop to create a stand-alone wall of flowers! Optionally, add valance hangers and a 2nd crossbar to the backdrop to hang sheers in front to frame the wall. The 2nd crossbar also creates a space to hold flower garlands and flowering tree branches. With or without the pipe and drape hardware, this flower kit offers all the options you need to create the dramatic flair that will send your event over the top! This Flower Wall Kit contains:
  • 24 Pcs Pink & Cream Hydrangea Flower Walls with soft and silky 2" wide flowers
  • 64 Square feet of Extra Strength Polypropylene Fencing, lightweight but incredibly tough
  • 100 Zip Ties (wire ties), each 8" long, to secure the walls to the fencing and optionally to secure the wall to a pipe and drape backdrop

  • The long side of the flower wall is 25" and the shorter side is 17". Depending on how you place the walls, you can have 6 rows, 4 walls per row or 4 rows, 6 walls per row. We provide enough walls so that the overhang of the flowers will conceal the fencing. Do a little fluffing and you're set! Optionally add string lights, signs, monograms & logos. Since the back of the flower walls and the fencing are a grid, there are tons of attachment points for extra goodies. One huge advantage of using the pipe & drape backdrop is that it is much easier to assemble the wall once the fencing has been attached to the pipes. Another advantage is that it's easy to swap out the look you’re after. If you have a flower wall kit and need a different color or say you want greenery, just clip the wire ties that hold the entire wall to the backdrop pipes and swap in a different kit! ]]>
    flowerwallkits pipe-and-drape-backdrops silkflowers
    wild-page1Professional Grade Pipe & Drape Backdrop to create a stand-alone wall of flowers! Optionally, add valance hangers and a 2nd crossbar to the backdrop to hang sheers in front to frame the wall. The 2nd crossbar also creates a space to hold flower garlands and flowering tree branches. With or without the pipe and drape hardware, this flower kit offers all the options you need to create the dramatic flair that will send your event over the top! This Flower Wall Kit contains:
  • 24 Pcs Pink & Ivory Roses with Ivory Hydrangea Flower Walls with 4" wide roses and 2.5" wide hydrangea
  • 64 Square feet of Extra Strength Polypropylene Fencing, lightweight but incredibly tough
  • 100 Zip Ties (wire ties), each 8" long, to secure the walls to the fencing and optionally to secure the wall to a pipe and drape backdrop

  • The long side of the flower wall is 27" and the shorter side is 20". Depending on how you place the walls, you can have 6 rows, 4 walls per row or 4 rows, 6 walls per row. We provide enough walls so that the overhang of the flowers will conceal the fencing. Do a little fluffing and you're set! Optionally add string lights, signs, monograms & logos. Since the back of the flower walls and the fencing are a grid, there are tons of attachment points for extra goodies. One huge advantage of using the pipe & drape backdrop is that it is much easier to assemble the wall once the fencing has been attached to the pipes. Another advantage is that it's easy to swap out the look you’re after. If you have a flower wall kit and need a different color or say you want greenery, just clip the wire ties that hold the entire wall to the backdrop pipes and swap in a different kit!]]>
    flowerwallkits pipe-and-drape-backdrops silkflowers
    wild-pageflowerwallkits11Professional Grade Pipe & Drape Backdrop to create a stand-alone wall of flowers! Optionally, add valance hangers and a 2nd crossbar to the backdrop to hang sheers in front to frame the wall. The 2nd crossbar also creates a space to hold flower garlands and flowering tree branches. With or without the pipe and drape hardware, this flower kit offers all the options you need to create the dramatic flair that will send your event over the top! This Flower Wall Kit contains:
  • 24 Pcs Pink Roses & Hydrangea Flower Walls with 4" wide roses and 2" wide hydrangea flowers
  • 64 Square feet of Extra Strength Polypropylene Fencing, lightweight but incredibly tough
  • 100 Zip Ties (wire ties), each 8" long, to secure the walls to the fencing and optionally to secure the wall to a pipe and drape backdrop

  • The long side of the flower wall is 25" and the shorter side is 18". Depending on how you place the walls, you can have 6 rows, 4 walls per row or 4 rows, 6 walls per row. We provide enough walls so that the overhang of the flowers will conceal the fencing. Do a little fluffing and you're set! Optionally add string lights, signs, monograms & logos. Since the back of the flower walls and the fencing are a grid, there are tons of attachment points for extra goodies. One huge advantage of using the pipe & drape backdrop is that it is much easier to assemble the wall once the fencing has been attached to the pipes. Another advantage is that it's easy to swap out the look you’re after. If you have a flower wall kit and need a different color or say you want greenery, just clip the wire ties that hold the entire wall to the backdrop pipes and swap in a different kit! ]]>
    flowerwallkits pipe-and-drape-backdrops silkflowers
    wild-pagefloral-walls-greenery-backdrops11https://s.yimg.com/aah/shopwildthings/flower-wall-kit-8-x-8-portable-backdrop-kit-pink-ivory-flowers-54.jpghttps://s.yimg.com/aah/shopwildthings/flower-wall-kit-8-x-8-portable-backdrop-kit-pink-ivory-flowers-55.jpgProfessional Grade Pipe & Drape Backdrop to create a stand-alone wall of flowers! Optionally, add valance hangers and a 2nd crossbar to the backdrop to hang sheers in front to frame the wall. The 2nd crossbar also creates a space to hold flower garlands and flowering tree branches. With or without the pipe and drape hardware, this flower kit offers all the options you need to create the dramatic flair that will send your event over the top! This Flower Wall Kit features our Blush Pink Roses & Ivory Hydrangeas Silk Flower Wall and contains:
  • 24 Pcs Pink & Ivory Flower Walls that are super full with large roses and hydrangeas
  • 64 Square feet of Extra Strength Polypropylene Fencing, lightweight but incredibly tough
  • 100 Zip Ties (wire ties), each 8" long, to secure the walls to the fencing and optionally to secure the wall to a pipe and drape backdrop

  • The long side of the flower wall frame is 23" and should be placed horizontally along the fencing. Four walls will make 1 row. The overhang of the flowers will conceal the fencing. We placed 2 rows across the top, 3 rows coming up from the bottom, then cut 2 walls to fill in the mid-section. Do a little fluffing and you're set! Optionally add string lights, signs & logos or use artificial flower blooms to accentuate as you desire. Since the back of the flower walls and the fencing are a grid, there are tons of attachment points for extra goodies. One huge advantage of using the pipe & drape backdrop is that it is much easier to assemble the wall once the fencing has been attached to the pipes. Another advantage is that it's easy to swap out the look you’re after. If you have a flower wall kit and need a different color or say you want greenery, just clip the wire ties that hold the entire wall to the backdrop pipes and swap in a different kit! ]]>
    flowerwallkits pipe-and-drape-backdrops wearisma
    wild-pagefloral-walls-greenery-backdrops11https://s.yimg.com/aah/shopwildthings/flower-wall-backdrop-kit-roses-33.jpghttps://s.yimg.com/aah/shopwildthings/flower-wall-backdrop-kit-roses-34.jpgProfessional Grade Pipe & Drape Backdrop to create a stand-alone wall of flowers! Optionally, add valance hangers and a 2nd crossbar to the backdrop to hang sheers in front to frame the wall. The 2nd crossbar also creates a space to hold flower garlands and flowering tree branches. With or without the pipe and drape hardware, this flower kit offers all the options you need to create the dramatic flair that will send your event over the top! This Flower Wall Kit features our Premium Pink Silk Roses & Green Leaves Flower Wall and contains:
  • 24 Pcs Pink Roses on Leafy Green Flower Walls that are super full with large roses
  • 64 Square feet of Extra Strength Polypropylene Fencing, lightweight but incredibly tough
  • 100 Zip Ties (wire ties), each 8" long, to secure the walls to the fencing and optionally to secure the wall to a pipe and drape backdrop

  • The long side of the flower wall frame is 23" and should be placed horizontally along the fencing. Four walls will make 1 row. The overhang of the flowers will conceal the fencing. We placed 2 rows across the top, 3 rows coming up from the bottom, then cut 2 walls to fill in the mid-section. Do a little fluffing and you're set! Optionally add string lights, signs & logos or use artificial flower blooms to accentuate as you desire. Since the back of the flower walls and the fencing are a grid, there are tons of attachment points for extra goodies. One huge advantage of using the pipe & drape backdrop is that it is much easier to assemble the wall once the fencing has been attached to the pipes. Another advantage is that it's easy to swap out the look you’re after. If you have a flower wall kit and need a different color or say you want greenery, just clip the wire ties that hold the entire wall to the backdrop pipes and swap in a different kit! ]]>
    flowerwallkits pipe-and-drape-backdrops wearisma
    wild-page1Professional Grade Pipe & Drape Backdrop to create a stand-alone wall of flowers! Optionally, add valance hangers and a 2nd crossbar to the backdrop to hang sheers in front to frame the wall. The 2nd crossbar also creates a space to hold flower garlands and flowering tree branches. With or without the pipe and drape hardware, this flower kit offers all the options you need to create the dramatic flair that will send your event over the top! This Flower Wall Kit contains:
  • 24 Pcs Pink, Purple & Ivory Flower Walls with floral variety ranging from 2" wide to 4.5" wide flowers
  • 64 Square feet of Extra Strength Polypropylene Fencing, lightweight but incredibly tough
  • 100 Zip Ties (wire ties), each 8" long, to secure the walls to the fencing and optionally to secure the wall to a pipe and drape backdrop

  • The long side of the flower wall is 26" and the shorter side is 19". Depending on how you place the walls, you can have 6 rows, 4 walls per row or 4 rows, 6 walls per row. We provide enough walls so that the overhang of the flowers will conceal the fencing. Do a little fluffing and you're set! Optionally add string lights, signs, monograms & logos. Since the back of the flower walls and the fencing are a grid, there are tons of attachment points for extra goodies. One huge advantage of using the pipe & drape backdrop is that it is much easier to assemble the wall once the fencing has been attached to the pipes. Another advantage is that it's easy to swap out the look you’re after. If you have a flower wall kit and need a different color or say you want greenery, just clip the wire ties that hold the entire wall to the backdrop pipes and swap in a different kit!]]>
    flowerwallkits pipe-and-drape-backdrops silkflowers
    wild-pageflowerwallkits11Professional Grade Pipe & Drape Backdrop to create a stand-alone wall of flowers! Optionally, add valance hangers and a 2nd crossbar to the backdrop to hang sheers in front to frame the wall. The 2nd crossbar also creates a space to hold flower garlands and flowering tree branches. With or without the pipe and drape hardware, this flower kit offers all the options you need to create the dramatic flair that will send your event over the top! This Flower Wall Kit contains:
  • 24 Pcs Premium Coral Pink Flower Walls that are super full with 2 1/2" wide flowers
  • 64 Square feet of Extra Strength Polypropylene Fencing, lightweight but incredibly tough
  • 100 Zip Ties (wire ties), each 8" long, to secure the walls to the fencing and optionally to secure the wall to a pipe and drape backdrop

  • The long side of the flower wall is 26.5" and the shorter side is 19". Depending on how you place the walls, you can have 6 rows, 4 walls per row or 4 rows, 6 walls per row. We provide enough walls so that the overhang of the flowers will conceal the fencing. Do a little fluffing and you're set! Optionally add string lights, signs, monograms & logos. Since the back of the flower walls and the fencing are a grid, there are tons of attachment points for extra goodies. One huge advantage of using the pipe & drape backdrop is that it is much easier to assemble the wall once the fencing has been attached to the pipes. Another advantage is that it's easy to swap out the look you’re after. If you have a flower wall kit and need a different color or say you want greenery, just clip the wire ties that hold the entire wall to the backdrop pipes and swap in a different kit! ]]>
    flowerwallkits pipe-and-drape-backdrops silkflowers
  • 24 Pcs Cream Hydrangea Flower Walls
  • 64 Square feet of Extra Strength Polypropylene Fencing, lightweight but incredibly tough
  • 100 Zip Ties (wire ties), each 8" long, to secure the walls to the fencing and optionally to secure the wall to a pipe and drape backdrop
  • To make the exact kit like the totally decorated photo with curtains and flowers, you can add these optional accessories:
  • 1 pc This Kit #999199 which includes the flower panels, backdrop fencing to attach it to, and wire ties.
  • 1pc #183029 Pro Pipe & Drape Backdrop 8' Tall x 6-10' Wide
  • 6 pcs #143114 Frosted Eucalyptus OR 6 pcs #143148
  • 3 Pcs #750199 Silk Rose Set of 4 Pink
  • 3 pcs #750198 Silk Rose Set of 3 Ivory One huge advantage of using the pipe & drape backdrop is that it is much easier to assemble the wall once the fencing has been attached to the pipes. Another advantage is that it's easy to swap out the look you’re after. If you have a flower wall kit and need a different color or say you want greenery, just clip the wire ties that hold the entire wall to the backdrop pipes and swap in a different kit! ]]>flowerwallkits pipe-and-drape-backdrops wearismawild-page1Professional Grade Pipe & Drape Backdrop to create a stand-alone wall of flowers! Optionally, add valance hangers and a 2nd crossbar to the backdrop to hang sheers in front to frame the wall. The 2nd crossbar also creates a space to hold flower garlands and flowering tree branches. With or without the pipe and drape hardware, this flower kit offers all the options you need to create the dramatic flair that will send your event over the top! This Flower Wall Kit contains:
  • 24 Pcs Pure White Premium Hydrangea Flower Walls with 2" wide hydrangea
  • 64 Square feet of Extra Strength Polypropylene Fencing, lightweight but incredibly tough
  • 100 Zip Ties (wire ties), each 8" long, to secure the walls to the fencing and optionally to secure the wall to a pipe and drape backdrop

  • The long side of the flower wall is 26" and the shorter side is 18". Depending on how you place the walls, you can have 6 rows, 4 walls per row or 4 rows, 6 walls per row. We provide enough walls so that the overhang of the flowers will conceal the fencing. Do a little fluffing and you're set! Optionally add string lights, signs, monograms & logos. Since the back of the flower walls and the fencing are a grid, there are tons of attachment points for extra goodies. One huge advantage of using the pipe & drape backdrop is that it is much easier to assemble the wall once the fencing has been attached to the pipes. Another advantage is that it's easy to swap out the look you’re after. If you have a flower wall kit and need a different color or say you want greenery, just clip the wire ties that hold the entire wall to the backdrop pipes and swap in a different kit!]]>
    flowerwallkits pipe-and-drape-backdrops silkflowers
    wild-page1Professional Grade Pipe & Drape Backdrop to create a stand-alone wall of flowers! Optionally, add valance hangers and a 2nd crossbar to the backdrop to hang sheers in front to frame the wall. The 2nd crossbar also creates a space to hold flower garlands and flowering tree branches. With or without the pipe and drape hardware, this flower kit offers all the options you need to create the dramatic flair that will send your event over the top! This Flower Wall Kit contains:
  • 24 Pcs Pure White Roses and Hydrangea Flower Walls with 4" wide roses and 2" wide hydrangea
  • 64 Square feet of Extra Strength Polypropylene Fencing, lightweight but incredibly tough
  • 100 Zip Ties (wire ties), each 8" long, to secure the walls to the fencing and optionally to secure the wall to a pipe and drape backdrop

  • The long side of the flower wall is 25.5" and the shorter side is 19". Depending on how you place the walls, you can have 6 rows, 4 walls per row or 4 rows, 6 walls per row. We provide enough walls so that the overhang of the flowers will conceal the fencing. Do a little fluffing and you're set! Optionally add string lights, signs, monograms & logos. Since the back of the flower walls and the fencing are a grid, there are tons of attachment points for extra goodies. One huge advantage of using the pipe & drape backdrop is that it is much easier to assemble the wall once the fencing has been attached to the pipes. Another advantage is that it's easy to swap out the look you’re after. If you have a flower wall kit and need a different color or say you want greenery, just clip the wire ties that hold the entire wall to the backdrop pipes and swap in a different kit!]]>
    flowerwallkits pipe-and-drape-backdrops silkflowers
    wild-pageflowerwallkits11Professional Grade Pipe & Drape Backdrop to create a stand-alone wall of flowers! Optionally, add valance hangers and a 2nd crossbar to the backdrop to hang sheers in front to frame the wall. The 2nd crossbar also creates a space to hold flower garlands and flowering tree branches. With or without the pipe and drape hardware, this flower kit offers all the options you need to create the dramatic flair that will send your event over the top! This Flower Wall Kit contains:
  • 24 Pcs Dark Purple Hydrangea Flower Walls with luscious 2" wide flowers
  • 64 Square feet of Extra Strength Polypropylene Fencing, lightweight but incredibly tough
  • 100 Zip Ties (wire ties), each 8" long, to secure the walls to the fencing and optionally to secure the wall to a pipe and drape backdrop

  • The long side of the flower wall is 25" and the shorter side is 17". Depending on how you place the walls, you can have 6 rows, 4 walls per row or 4 rows, 6 walls per row. We provide enough walls so that the overhang of the flowers will conceal the fencing. Do a little fluffing and you're set! Optionally add string lights, signs, monograms & logos. Since the back of the flower walls and the fencing are a grid, there are tons of attachment points for extra goodies. One huge advantage of using the pipe & drape backdrop is that it is much easier to assemble the wall once the fencing has been attached to the pipes. Another advantage is that it's easy to swap out the look you’re after. If you have a flower wall kit and need a different color or say you want greenery, just clip the wire ties that hold the entire wall to the backdrop pipes and swap in a different kit! ]]>
    flowerwallkits pipe-and-drape-backdrops silkflowers
    wild-pageflowerwallkits11Professional Grade Pipe & Drape Backdrop to create a stand-alone wall of flowers! Optionally, add valance hangers and a 2nd crossbar to the backdrop to hang sheers in front to frame the wall. The 2nd crossbar also creates a space to hold flower garlands and flowering tree branches. With or without the pipe and drape hardware, this flower kit offers all the options you need to create the dramatic flair that will send your event over the top! This Flower Wall Kit contains:
  • 24 Pcs Premium Purple Silk Roses & Hydrangea Flower Walls that are super full with 4" wide roses and 2" wide hydrangeas
  • 64 Square feet of Extra Strength Polypropylene Fencing, lightweight but incredibly tough
  • 100 Zip Ties (wire ties), each 8" long, to secure the walls to the fencing and optionally to secure the wall to a pipe and drape backdrop

  • The long side of the flower wall is 27" and the shorter side is 19". Depending on how you place the walls, you can have 6 rows, 4 walls per row or 4 rows, 6 walls per row. We provide enough walls so that the overhang of the flowers will conceal the fencing. Do a little fluffing and you're set! Optionally add string lights, signs, monograms & logos. Since the back of the flower walls and the fencing are a grid, there are tons of attachment points for extra goodies. One huge advantage of using the pipe & drape backdrop is that it is much easier to assemble the wall once the fencing has been attached to the pipes. Another advantage is that it's easy to swap out the look you’re after. If you have a flower wall kit and need a different color or say you want greenery, just clip the wire ties that hold the entire wall to the backdrop pipes and swap in a different kit! ]]>
    flowerwallkits pipe-and-drape-backdrops silkflowers
    wild-page1Professional Grade Pipe & Drape Backdrop to create a stand-alone wall of flowers! Optionally, add valance hangers and a 2nd crossbar to the backdrop to hang sheers in front to frame the wall. The 2nd crossbar also creates a space to hold flower garlands and flowering tree branches. With or without the pipe and drape hardware, this flower kit offers all the options you need to create the dramatic flair that will send your event over the top! This Flower Wall Kit contains:
  • 24 Pcs Pink & Purple Roses and Hydrangea Flower Walls with 4" wide roses and 2.5" wide hydrangea
  • 64 Square feet of Extra Strength Polypropylene Fencing, lightweight but incredibly tough
  • 100 Zip Ties (wire ties), each 8" long, to secure the walls to the fencing and optionally to secure the wall to a pipe and drape backdrop

  • The long side of the flower wall is 26" and the shorter side is 18". Depending on how you place the walls, you can have 6 rows, 4 walls per row or 4 rows, 6 walls per row. We provide enough walls so that the overhang of the flowers will conceal the fencing. Do a little fluffing and you're set! Optionally add string lights, signs, monograms & logos. Since the back of the flower walls and the fencing are a grid, there are tons of attachment points for extra goodies. One huge advantage of using the pipe & drape backdrop is that it is much easier to assemble the wall once the fencing has been attached to the pipes. Another advantage is that it's easy to swap out the look you’re after. If you have a flower wall kit and need a different color or say you want greenery, just clip the wire ties that hold the entire wall to the backdrop pipes and swap in a different kit!]]>
    flowerwallkits pipe-and-drape-backdrops silkflowers
    wild-pageflowerwallkits11Professional Grade Pipe & Drape Backdrop to create a stand-alone wall of flowers! Optionally, add valance hangers and a 2nd crossbar to the backdrop to hang sheers in front to frame the wall. The 2nd crossbar also creates a space to hold flower garlands and flowering tree branches. With or without the pipe and drape hardware, this flower kit offers all the options you need to create the dramatic flair that will send your event over the top! This Flower Wall Kit contains:
  • 24 Pcs Red Hydrangea Flower Walls with 2" wide flowers and dark seed centers
  • 64 Square feet of Extra Strength Polypropylene Fencing, lightweight but incredibly tough
  • 100 Zip Ties (wire ties), each 8" long, to secure the walls to the fencing and optionally to secure the wall to a pipe and drape backdrop

  • The long side of the flower wall is 25" and the shorter side is 17". Depending on how you place the walls, you can have 6 rows, 4 walls per row or 4 rows, 6 walls per row. We provide enough walls so that the overhang of the flowers will conceal the fencing. Do a little fluffing and you're set! Optionally add string lights, signs, monograms & logos. Since the back of the flower walls and the fencing are a grid, there are tons of attachment points for extra goodies. One huge advantage of using the pipe & drape backdrop is that it is much easier to assemble the wall once the fencing has been attached to the pipes. Another advantage is that it's easy to swap out the look you’re after. If you have a flower wall kit and need a different color or say you want greenery, just clip the wire ties that hold the entire wall to the backdrop pipes and swap in a different kit! ]]>
    flowerwallkits pipe-and-drape-backdrops silkflowers
    wild-pageflowerwallkits11Professional Grade Pipe & Drape Backdrop to create a stand-alone wall of flowers! Optionally, add valance hangers and a 2nd crossbar to the backdrop to hang sheers in front to frame the wall. The 2nd crossbar also creates a space to hold flower garlands and flowering tree branches. With or without the pipe and drape hardware, this flower kit offers all the options you need to create the dramatic flair that will send your event over the top! This Flower Wall Kit contains:
  • 24 Pcs Red Silk Plumeria Flower Walls that are super full with 2" wide blossoms
  • 64 Square feet of Extra Strength Polypropylene Fencing, lightweight but incredibly tough
  • 100 Zip Ties (wire ties), each 8" long, to secure the walls to the fencing and optionally to secure the wall to a pipe and drape backdrop

  • The long side of the flower wall is 25" and the shorter side is 18". Depending on how you place the walls, you can have 6 rows, 4 walls per row or 4 rows, 6 walls per row. We provide enough walls so that the overhang of the flowers will conceal the fencing. Do a little fluffing and you're set! Optionally add string lights, signs, monograms & logos. Since the back of the flower walls and the fencing are a grid, there are tons of attachment points for extra goodies. One huge advantage of using the pipe & drape backdrop is that it is much easier to assemble the wall once the fencing has been attached to the pipes. Another advantage is that it's easy to swap out the look you’re after. If you have a flower wall kit and need a different color or say you want greenery, just clip the wire ties that hold the entire wall to the backdrop pipes and swap in a different kit! ]]>
    flowerwallkits pipe-and-drape-backdrops silkflowers
    wild-page1Professional Grade Pipe & Drape Backdrop to create a stand-alone wall of flowers! Optionally, add valance hangers and a 2nd crossbar to the backdrop to hang sheers in front to frame the wall. The 2nd crossbar also creates a space to hold flower garlands and flowering tree branches. With or without the pipe and drape hardware, this flower kit offers all the options you need to create the dramatic flair that will send your event over the top! This Flower Wall Kit contains:
  • 24 Pcs Red Rose and Green Leaf Flower Walls with gorgeous 4" wide flowers
  • 64 Square feet of Extra Strength Polypropylene Fencing, lightweight but incredibly tough
  • 100 Zip Ties (wire ties), each 8" long, to secure the walls to the fencing and optionally to secure the wall to a pipe and drape backdrop

  • The long side of the flower wall is 25" and the shorter side is 19". Depending on how you place the walls, you can have 6 rows, 4 walls per row or 4 rows, 6 walls per row. We provide enough walls so that the overhang of the flowers will conceal the fencing. Do a little fluffing and you're set! Optionally add string lights, signs, monograms & logos. Since the back of the flower walls and the fencing are a grid, there are tons of attachment points for extra goodies. One huge advantage of using the pipe & drape backdrop is that it is much easier to assemble the wall once the fencing has been attached to the pipes. Another advantage is that it's easy to swap out the look you’re after. If you have a flower wall kit and need a different color or say you want greenery, just clip the wire ties that hold the entire wall to the backdrop pipes and swap in a different kit!]]>
    flowerwallkits pipe-and-drape-backdrops silkflowers
    wild-page1Professional Grade Pipe & Drape Backdrop to create a stand-alone wall of flowers! Optionally, add valance hangers and a 2nd crossbar to the backdrop to hang sheers in front to frame the wall. The 2nd crossbar also creates a space to hold flower garlands and flowering tree branches. With or without the pipe and drape hardware, this flower kit offers all the options you need to create the dramatic flair that will send your event over the top! This Flower Wall Kit contains:
  • 24 Pcs Premium Silk Rich Red Roses, Peonies and Hydrangea Flower Walls with 4" wide roses, 3.5" wide peonies and 2.5" wide hydrangea
  • 64 Square feet of Extra Strength Polypropylene Fencing, lightweight but incredibly tough
  • 100 Zip Ties (wire ties), each 8" long, to secure the walls to the fencing and optionally to secure the wall to a pipe and drape backdrop

  • The long side of the flower wall is 27" and the shorter side is 19.5". Depending on how you place the walls, you can have 6 rows, 4 walls per row or 4 rows, 6 walls per row. We provide enough walls so that the overhang of the flowers will conceal the fencing. Do a little fluffing and you're set! Optionally add string lights, signs, monograms & logos. Since the back of the flower walls and the fencing are a grid, there are tons of attachment points for extra goodies. One huge advantage of using the pipe & drape backdrop is that it is much easier to assemble the wall once the fencing has been attached to the pipes. Another advantage is that it's easy to swap out the look you’re after. If you have a flower wall kit and need a different color or say you want greenery, just clip the wire ties that hold the entire wall to the backdrop pipes and swap in a different kit!]]>
    flowerwallkits pipe-and-drape-backdrops silkflowers
    wild-pageflowerwallkits11Professional Grade Pipe & Drape Backdrop to create a stand-alone wall of flowers! Optionally, add valance hangers and a 2nd crossbar to the backdrop to hang sheers in front to frame the wall. The 2nd crossbar also creates a space to hold flower garlands and flowering tree branches. With or without the pipe and drape hardware, this flower kit offers all the options you need to create the dramatic flair that will send your event over the top! This Flower Wall Kit contains:
  • 24 Pcs Premium Cream Roses & Green Leaves Flower Walls that are super full with 1 1/2" wide roses
  • 64 Square feet of Extra Strength Polypropylene Fencing, lightweight but incredibly tough
  • 100 Zip Ties (wire ties), each 8" long, to secure the walls to the fencing and optionally to secure the wall to a pipe and drape backdrop

  • The long side of the flower wall is 25" and the shorter side is 17". Depending on how you place the walls, you can have 6 rows, 4 walls per row or 4 rows, 6 walls per row. We provide enough walls so that the overhang of the flowers will conceal the fencing. Do a little fluffing and you're set! Optionally add string lights, signs, monograms & logos. Since the back of the flower walls and the fencing are a grid, there are tons of attachment points for extra goodies. One huge advantage of using the pipe & drape backdrop is that it is much easier to assemble the wall once the fencing has been attached to the pipes. Another advantage is that it's easy to swap out the look you’re after. If you have a flower wall kit and need a different color or say you want greenery, just clip the wire ties that hold the entire wall to the backdrop pipes and swap in a different kit! ]]>
    flowerwallkits pipe-and-drape-backdrops wearisma
    wild-pageflowerwallkits11Professional Grade Pipe & Drape Backdrop to create a stand-alone wall of flowers! Optionally, add valance hangers and a 2nd crossbar to the backdrop to hang sheers in front to frame the wall. The 2nd crossbar also creates a space to hold flower garlands and flowering tree branches. With or without the pipe and drape hardware, this flower kit offers all the options you need to create the dramatic flair that will send your event over the top! This Flower Wall Kit contains:
  • 24 Pcs White Hydrangea Flower Walls with gorgeous 2" wide flowers
  • 64 Square feet of Extra Strength Polypropylene Fencing, lightweight but incredibly tough
  • 100 Zip Ties (wire ties), each 8" long, to secure the walls to the fencing and optionally to secure the wall to a pipe and drape backdrop

  • The long side of the flower wall is 25" and the shorter side is 17". Depending on how you place the walls, you can have 6 rows, 4 walls per row or 4 rows, 6 walls per row. We provide enough walls so that the overhang of the flowers will conceal the fencing. Do a little fluffing and you're set! Optionally add string lights, signs, monograms & logos. Since the back of the flower walls and the fencing are a grid, there are tons of attachment points for extra goodies. One huge advantage of using the pipe & drape backdrop is that it is much easier to assemble the wall once the fencing has been attached to the pipes. Another advantage is that it's easy to swap out the look you’re after. If you have a flower wall kit and need a different color or say you want greenery, just clip the wire ties that hold the entire wall to the backdrop pipes and swap in a different kit! ]]>
    flowerwallkits pipe-and-drape-backdrops silkflowers
    wild-pagefloral-walls-greenery-backdrops11https://s.yimg.com/aah/shopwildthings/flower-wall-kit-8-x-8-portable-backdrop-kit-white-roses-on-green-leaves-50.jpghttps://s.yimg.com/aah/shopwildthings/flower-wall-kit-8-x-8-portable-backdrop-kit-white-roses-on-green-leaves-51.jpgProfessional Grade Pipe & Drape Backdrop to create a stand-alone wall of flowers! Optionally, add valance hangers and a 2nd crossbar to the backdrop to hang sheers in front to frame the wall. The 2nd crossbar also creates a space to hold flower garlands and flowering tree branches. With or without the pipe and drape hardware, this flower kit offers all the options you need to create the dramatic flair that will send your event over the top! This Flower Wall Kit features our Premium White Silk Roses & Green Leaves Flower Wall and contains:
  • 24 Pcs White Roses on Leafy Green Flower Walls that are super full with large roses
  • 64 Square feet of Extra Strength Polypropylene Fencing, lightweight but incredibly tough
  • 100 Zip Ties (wire ties), each 8" long, to secure the walls to the fencing and optionally to secure the wall to a pipe and drape backdrop

  • The long side of the flower wall frame is 23" and should be placed horizontally along the fencing. Four walls will make 1 row. The overhang of the flowers will conceal the fencing. We placed 2 rows across the top, 3 rows coming up from the bottom, then cut 2 walls to fill in the mid-section. Do a little fluffing and you're set! Optionally add string lights, signs & logos or use artificial flower blooms to accentuate as you desire. Since the back of the flower walls and the fencing are a grid, there are tons of attachment points for extra goodies. One huge advantage of using the pipe & drape backdrop is that it is much easier to assemble the wall once the fencing has been attached to the pipes. Another advantage is that it's easy to swap out the look you’re after. If you have a flower wall kit and need a different color or say you want greenery, just clip the wire ties that hold the entire wall to the backdrop pipes and swap in a different kit! ]]>
    flowerwallkits pipe-and-drape-backdrops wearisma
    wild-pagefloral-walls-greenery-backdrops11https://s.yimg.com/aah/shopwildthings/flower-wall-kit-8-x-8-portable-backdrop-kit-white-flowers-122.jpghttps://s.yimg.com/aah/shopwildthings/flower-wall-kit-8-x-8-portable-backdrop-kit-white-flowers-123.jpgProfessional Grade Pipe & Drape Backdrop to create a stand-alone wall of flowers! Optionally, add valance hangers and a 2nd crossbar to the backdrop to hang sheers in front to frame the wall. The 2nd crossbar also creates a space to hold flower garlands and flowering tree branches. With or without the pipe and drape hardware, this flower kit offers all the options you need to create the dramatic flair that will send your event over the top! This Flower Wall Kit features our Pure White Roses, Peonies & Hydrangeas Silk Flower Wall and contains:
  • 24 Pcs White Flower Walls that are super full with large roses, peonies and hydrangeas
  • 64 Square feet of Extra Strength Polypropylene Fencing, lightweight but incredibly tough
  • 100 Zip Ties (wire ties), each 8" long, to secure the walls to the fencing and optionally to secure the wall to a pipe and drape backdrop

  • The long side of the flower wall frame is 23" and should be placed horizontally along the fencing. Four walls will make 1 row. The overhang of the flowers will conceal the fencing. We placed 2 rows across the top, 3 rows coming up from the bottom, then cut 2 walls to fill in the mid-section. Do a little fluffing and you're set! Optionally add string lights, signs & logos or use artificial flower blooms to accentuate as you desire. Since the back of the flower walls and the fencing are a grid, there are tons of attachment points for extra goodies. One huge advantage of using the pipe & drape backdrop is that it is much easier to assemble the wall once the fencing has been attached to the pipes. Another advantage is that it's easy to swap out the look you’re after. If you have a flower wall kit and need a different color or say you want greenery, just clip the wire ties that hold the entire wall to the backdrop pipes and swap in a different kit! ]]>
    flowerwallkits pipe-and-drape-backdrops wearisma
    wild-pagefloral-walls-greenery-backdrops1https://s.yimg.com/aah/shopwildthings/flower-wall-16-x-24-silk-hydrangeas-pink-28.jpghttps://s.yimg.com/aah/shopwildthings/flower-wall-16-x-24-silk-hydrangeas-pink-29.jpg*The frame on this durable, bendable mat is 15 1/2" x 23" but the flowers extend over the edges making the actual measurement about 17" x 24" and it's 1 1/2" deep. Chocked full of the glorious Hawaiian Frangipani Flower, each soft and luscious bloom is approx. 2" wide. Create your own floral paradise by immersing your guests in tropical floral bliss! This mat only weighs 12 oz. which allows for many display possibilities. The flowers are attached to a sturdy, plastic grid frame that is completely flexible. Two sides of the frame have plastic pegs which insert into the holes on the other two sides of the frame so you can attach as many mats as you need to cover areas small or large. The flowers extend over the edge of the mat so the grid is pretty well hidden. The mat is so flexible that you can actually attach the mat to itself, creating a circular floral vase! The grids are an inch square which makes it super easy to work with for attaching the frame to another surface. We'd recommend floral wire or wire ties as an extra measure for keeping them secured. Create breath-taking wedding and event Decor by attaching to a trellis or Arch. Fashion a stunning wall of flowers behind a head table which can double as an elegant photo backdrop. Use to mask or enhance a column, wall or door and accent with a colorful rose monogram or logo to mark the occasion! Pair with our identical Ivory Flower Wall or outline with a lively green wall like Boxwood Landscape Wall. If you want to create a design with other materials you can easily part the flowers and use the grid to attach items. If hanging from a wall or fence, use the grids to intertwine Fairy String Lights or create dimension with your flower wall by adding beautiful draping blossoms. This mat is an ideal size to use on drop ceilings with metal grids. Create a dreamy floral canopy by suspending the mat with magnet hooks, crystal or pearl strands. Hang sparkling crystal ornaments for added glam. If you need a wall that will be seen from both sides, use the easily accessible grids and tie 2 mats back-to-back. You can even cut the plastic grid frame to make creative shapes or use to cover the bottom of a stand. Many, many ways to use this Floral Wall Mat to make your dream garden a reality! TO AVOID THE LOOK OF "SEAMS" ON A FLOWER WALL USING A PIPE AND DRAPE STRUCTURE: The most critical point is to make sure that each wall panel is secured in multiple spots, not only to the pipes but to each adjoining panel as well. The tie should be a material that won't relax or stretch like burlap twine, wire ties or zip ties. When displaying multiple panels next to each other, each wall needs to be pulled taut so the seams don't show. The flowers extend over the frame, hiding the pipes while creating a seamless look. Another key is to secure each panel to the pipe AND to the adjoining panel in at least 3 spots. You can also connect the panels by using the pegs & holes on the sides of the plastic frame. Additionally, running picture wire horizontally, vertically and diagonally on the pipe and drape structure before adding the walls allows for a firmer background to support the walls. Please view our instructional video.]]>artificialgreenery floral-walls-greenery-backdrops silkflowers wedding-dcor effectively-using-spectacular-silk-flowerswild-pageflowerwallkits1cream-roses-flower-wall-backdropwhite-roses-wedding-walls-of-flowerswedding-wall-of-flowers-faux-ivory-rosesivory-floral-backdrop-panel-rosescurved-flower-wall-for-arches-and-columnspremium-flower-wall-huge-cream-silk-flowerssilk-flower-wall-cream-roses-and-hydrangeaivory-plumeria-flower-wall-mat-2feetivory-flower-wall-wedding-backdropcream-flower-wall-wedding-photo-backdropoff-white-flower-mat-backdrop-wallpremium-pure-white-rose-flower-wallwhite-rose-hydrangea-flower-wallfloral-backdrop-wedding-photo-wall-whitewhite-flower-wall-hydrangeaswedding-flower-wall-backdrop-creamy-whitepink-ivory-roses-flower-wallpeach-pink-ivory-flower-wallivory-peach-flower-wallsblush-pink-cherry-blossom-flower-wall-matroses-blush-pink-floral-wall-panelblush-pink-premium-flower-wall-hydrangeablush-pink-flower-wall-wedding-backdroppink-and-cream-hydrangea-flower-wallflower-wall-pink-rosespink-flower-backdrop-walltwo-tone-wall-of-flowers-blush-pinkpink-silk-roses-flower-wall-backdropextra-full-mixed-variety-flower-wall-backdropcolorful-flower-wall-panel-backdroppurple-pink-flower-wall-panelspurple-roses-silk-flower-wall-backdroppurple-silk-flower-backdrop-wall-panelsblack-flower-wall-backdrop-panelsilk-red-roses-wedding-flower-wall-matred-flower-wall-dark-center-bloomsflower-wall-redpremium-red-silk-flower-wall-extra-fullgold-hydrangea-walls-silk-wedding-flowerssilk-flower-walls-metallic-silver-event-backdropsflower-wall-backdrop-aqua-bluehydrangea-silk-flower-wall-mat-greenhydrangea-flower-wall-backdrop-kit64sqft-complete-flower-wall-backdrop-kitflower-wall-backdrop-kit-8ft8ft-portable-flower-wall-backdrop-kit8ft-flower-wall-backdrop-kit-pink-rosesflower-wall-kit-pink-roses-8ft-portable-backdrop4pc-silk-rose-flower-wall-set-red4pc-silk-rose-flower-wall-set-white4pc-silk-rose-flower-wall-set-ivory4pc-silk-rose-flower-wall-set-pinkfoam-roses-wall-backdrop4-giant-ivory-real-feel-foam-roseslarge-pink-foam-flowers-wallscapegiant-foam-floating-rose-with-stem-ivory-17inchhuge-white-foam-flower-20inch-wide20inch-wide-giant-foam-flower-ivorypaper-flower-rose-gardenia-off-white-12inchespaper-flower-rose-gardenia-off-white-14inchespaper-flower-rose-gardenia-off-white-19inchespaper-flower-daisy-off-white-12inchespaper-flower-dahlia-off-white-12inchespaper-flower-cosmos-off-white-11inchesartificial-grass-wall-mat-natural-greengreen-living-wall-mat-artificial-hedgesboxwood-greenery-wall-mat-11inchesartificial-ferns-green-wall-panel-fr-20infaux-boxwood-plant-wall-mat-fr-20inhuge-artificial-green-wall-assorted-foliage-40inartificial--boxwood-greenery-garden-wallartificial-greenery-garden-wall-panelsboxwood-wall-artificial-green-panelartificial-boxwood-fire-rated-greenery-wallartificial-boxwood-mat-greenery-backdropgreenery-foliage-wall-matartificial-grass-mat-runnerfloral-chandelierfloral-chandelier-event-kit8ft-lush-mixed-greenery-backdrop-wall-kitboxwood-greenery-wall-backdrop-kit-8ftfire-rated-greenery-backdrop-wall-kitartificialgreenerywhite-flower-chandelier-wedding-decorfloral-walls-greenery-backdropsflfadefasilkflowersropokibabrandspmybuswtgereafreestanding-flower-wall-frame-metal-setof4picture-frame-cutsouts-white-plastic-4pc3d-pvc-laser-cut-backdrop-8ft-tall-propxlrg-5pc-freestanding-3d-laser-cut-backdroppaintable-flower-backdrop-laser-cut-3d5pc-xlrg-event-backdrop-freestanding-archesflower-wall-backdrop-stand-instructions1https://s.yimg.com/aah/shopwildthings/flower-wall-panels-for-sale-44.jpghttps://s.yimg.com/aah/shopwildthings/flower-wall-panels-for-sale-45.jpgWhen it comes to Wedding Flower Walls, most clients want them but few can stomach the cost of "real" florals. Measure the space you'd like to cover, and then choose how many of our panels you'll need to cover that space. We are confident that our pricing will make this purchase a no-brainer, no matter how many square feet you need to cover! Event Planners Rejoice! You'll sell this set up again and again! We LOVE real flowers and our floral designer clients do the most beautiful and creative work. Even many of them have told us that Artificial Flower Walls can be mixed with real florals around the rest of the event for a spectacular and more budget-friendly event. Silk Flower Walls are also a first-choice for Portrait Photographers for a beautiful and affordable Floral Backdrop that will stay beautiful forever. Our Flower Wall Panels are designed for ease-of-use. They look so very real, but the back is created using a plastic grid that has holes for hanging. We've even used thumbtacks to hang them when needed! Staple guns work well, too. Simply attach them to whatever inexpensive plywood backdrop you've got handy, and it will be beautifully disguised by our Silk Flower Wall Panels!floral-centerpiece-kit picture-frame-cutsouts-white-plastic-4pcwild-pagecatrfatr1bend-branch-faux-white-flowering-tree-tallwhite-flowering-5ft-wedding-treefaux-cherry-blossom-tree-white-6ftcream-flowering-dogwood-tree-artificial-6-footwhite-dogwood-tree-flowering-lifesize-artificialsilk-weeping-cherry-tree-9ft-whitepink-dogwood-heart-shaped-tree-12-feetwhite-green-lifesize-flowering-tree-propartificial-cream-cherry-blossom-tree-6ftsnow-fountain-white-weeping-cherry--treecream-flowering-wisteria-tree-heart-archartificial-lifesize-artificial-flower-tree-propwhite-green-artificial-tree-lifesize-wedding-propcream-dogwood-lifesize-silk-flowering-treeartificial-cream-flowering-dogwood-tree-6ftartificial-cherry-blossom-tree-can-change-flowersfaux-pink-flowering-dogwood-tree-6ftlarge-pink-and-white-flowering-wedding-tree-archlarge-pink-artificial-flowering-wedding-treeartificial-pink-flowering-tree-archblush-pink-12-foot-artificial-tree-floweringlight-pink-event-design-tree-6-feet-flowers12ft-artificial-pink-dogwood-heart-shaped-treepink-cherry-tree-event-wedding-artificialfuchsia-flowering-tree-10ft-wedding-arch11ft-flowering-wisteria-tree-dark-fuchsia-pink7ft-artificial-wisteria-tree-flowering-purpleextra-large-artificial-tree-green-event-propartificial-weeping-willow-tree-greensilk-flower-garlandssilkflowersropokiba1https://s.yimg.com/aah/shopwildthings/flowering-artificial-wedding-trees-45.jpghttps://s.yimg.com/aah/shopwildthings/flowering-artificial-wedding-trees-46.jpg Use them as is - they take just moments to set up! You could also add Crystal Garlands, Pendants, and more if you'd like to add a little sparkle to the look. Add our Battery Operated LED Lights for a cool glow! Bend the branches so that they are shaped however you'd like!]]>wild-pageflowering-trees1https://s.yimg.com/aah/shopwildthings/flowering-cherry-blossom-tree-extra-full-6-tall-white-107.jpghttps://s.yimg.com/aah/shopwildthings/flowering-cherry-blossom-tree-extra-full-6-tall-white-108.jpgcompletely bendable! Shape it how you'd like and it WILL keep its shape. The base of the 10 main branches is a square metal housing which simply slides into the square holes on the trunk and the look is completely seamless. The branches meld perfectly into the trunk. Very quick and easy! In the center of the base of the top 4 branches there is an area about 1 1/2" in diameter that could easily hold a small bottle of scented oil (like cherry blossom!) or a battery operated DazzLED light! Worried about stability? Well don't. This tree weighs 21.7 lbs. and at the bottom is an 11 3/4" square metal plate. The tree trunk is attached to the base - they are 1 unit that will not come apart. Additionally, the metal base has 4 holes (each 3/4" in diameter) so you can 'permanently' install this tree. It's hard to believe but there are so many branches and blossoms that you could actually remove several of the main stems and use them in a vase and you won't notice them missing from the tree. Seriously, that's just how full it is! Add fairy string lights...OOH! Hang crystal garlands or crystal pendants and ornaments...AHH! You could even expound on the realistic qualities of this tree by placing in a planter box! Around the house this is perfect for a covered patio, sunroom or foyer. For restaurants, stores and hotels, welcome your guests with eye-popping blossoms and celebrate the holidays by decorating with colored LED string lights! If you're planning a large venue, place on a table and make this the grand showpiece of the room! You will be amazed by this elegant blooming beauty and when only the best will do for your event, choose the best with this easy up, pleasing to the eye, exquisite accent piece!]]>catrfatr floral-walls-greenery-backdrops gaandstwild-pagepinks1https://s.yimg.com/aah/shopwildthings/pink-flowering-artificial-trees-event-props-22.jpghttps://s.yimg.com/aah/shopwildthings/pink-flowering-artificial-trees-event-props-23.jpgSparkling Crystal Garlands, Pendants or Ornaments only enhances the look and feel of your venue. Around the house this is perfect for a covered patio, sunroom or foyer. For restaurants, stores and hotels, welcome your guests with eye-popping blossoms and celebrate the holidays by decorating with white or colored LED String Lights or butterfly garlands! If you're planning a large venue, place on a table and make this the grand showpiece of the room! It's sure hard to beat the beauty of a dogwood tree in full bloom so why not enjoy this elegant flowering tree year round! For sensational wedding and event decor, we work hard to get only the best so that you get only the best and our line of decorative flowering trees are yummy from top to bottom!]]>floral-walls-greenery-backdrops silkflowers ropokibawild-pagewhclde1https://s.yimg.com/aah/shopwildthings/dogwood-tree-flowering-ivory-artificial-7.jpghttps://s.yimg.com/aah/shopwildthings/dogwood-tree-flowering-ivory-artificial-8.jpgWe recommend attaching the stabilizers before assembling the branches. The branches are identical and have a metal housing on the end which simply slides into the square holes on the trunk and the look is completely seamless! In 5 minutes, you can assemble this tree and spread out the bendable branches for eye-popping decor! This tree weighs 44 lbs. Trees are one of natures' best gifts and they bring energy to the room, are visually pleasing and calming to the soul. Add some Butterfly Garlands or hang Firefly Fairy Pearl Lights for a dazzling nighttime effect. For special events, create a lovely focal point or use as a picturesque photo backdrop and what a gorgeous addition to wedding venues! For restaurants, stores, hotels or large venues, this tree adds elegance, vitality and gives a romantic garden feel. Add some Fairy String Lights or Sparkling Crystal Garlands, Pendants or Ornaments for extra scrumptousness! From top to bottom, this is a quality made tree and the extra stabilizers for the base were a special requirement of ours so that event planners and designers can relax, knowing this tree is stable and it's actually pretty easy to scootch around if you want to relocate it. To permanently install it, the base itself has 4 holes so you can secure this tree to the floor. For sensational wedding and event decor, we work hard to get only the best so that you get only the best and our line of decorative green and flowering trees are exotic and yummy from top to bottom!]]>floral-walls-greenery-backdrops silkflowers ropokibawild-pageflowering-trees1https://s.yimg.com/aah/shopwildthings/flowering-dogwood-tree-extra-full-6-tall-cream-131.jpghttps://s.yimg.com/aah/shopwildthings/flowering-dogwood-tree-extra-full-6-tall-cream-132.jpgcompletely bendable! Shape it how you'd like and it WILL keep its shape. The base of the 10 main branches is a square metal housing which simply slides into the square holes on the trunk and the look is completely seamless. The branches meld perfectly into the trunk. Very quick and easy! Worried about stability? Well don't. This tree weighs 18.2 lbs. and at the bottom is a 9 3/4" square metal plate. The tree trunk is attached to the base - they are 1 unit that will not come apart. Additionally, the metal base has 4 holes (each 3/4" in diameter) so you can 'permanently' install this tree. It's hard to believe but there are so many branches and blossoms that you could actually remove several of the main stems and use them in a vase and you won't notice them missing from the tree. Seriously, that's just how full it is! Add fairy string lights...OOH! Hang crystal garlands or crystal pendants and ornaments...AHH! You could even expound on the realistic qualities of this tree by placing in a planter box! Around the house this is perfect for a covered patio, sunroom or foyer. For restaurants, stores and hotels, welcome your guests with eye-popping blossoms and celebrate the holidays by decorating with colored LED string lights! If you're planning a large venue, place on a table and make this the grand showpiece of the room! You will be amazed by this elegant blooming beauty and when only the best will do for your event, choose the best with this easy up, pleasing to the eye, exquisite accent piece!]]>catrfatr floral-walls-greenery-backdrops gaandstwild-pageflowering-trees1https://s.yimg.com/aah/shopwildthings/pink-tree-for-events-dogwood-flowers-45.jpghttps://s.yimg.com/aah/shopwildthings/pink-tree-for-events-dogwood-flowers-46.jpgcompletely bendable! Shape it how you'd like and it WILL keep its shape. The base of the 10 main branches is a square metal housing which simply slides into the square holes on the trunk and the look is completely seamless. The branches meld perfectly into the trunk. Very quick and easy! Worried about stability? Well don't. This tree weighs 24.7 lbs. and at the bottom is a 12" square metal plate. The tree trunk is attached to the base - they are 1 unit that will not come apart. Additionally, the metal base has 4 holes (each 3/4" in diameter) so you can 'permanently' install this tree. It's hard to believe but there are so many branches and blossoms that you could actually remove several of the main stems and use them in a vase and you won't notice them missing from the tree. Seriously, that's just how full it is! Add fairy string lights...OOH! Hang crystal garlands or crystal pendants and ornaments...AHH! You could even expound on the realistic qualities of this tree by placing in a planter box! Around the house this is perfect for a covered patio, sunroom or foyer. For restaurants, stores and hotels, welcome your guests with eye-popping blossoms and celebrate the holidays by decorating with colored LED string lights! If you're planning a large venue, place on a table and make this the grand showpiece of the room! You will be amazed by this elegant blooming beauty and when only the best will do for your event, choose the best with this easy up, pleasing to the eye, exquisite accent piece!]]>catrfatr silkflowers gaandstwild-pageexlocu11https://s.yimg.com/aah/shopwildthings/flowering-cherry-blossom-pink-white-10-5-feet-tall-x-8-feet-wide-sideswept-create-arch-using-2-38.jpghttps://s.yimg.com/aah/shopwildthings/flowering-cherry-blossom-pink-white-10-5-feet-tall-x-8-feet-wide-sideswept-create-arch-using-2-39.jpgButterfly Garlands or Firefly Fairy Pearl Lights for a dazzling nighttime effect. For special events, create a one-of-a-kind focal point, use as a picturesque photo backdrop or form a floral canopy to provide an elegant setting for wedding ceremonies. For restaurants, stores, hotels or large venues, this tree brings color, height, energy and gives a garden feel but because of the height, it takes up minimal space. When placed next to a wall, it comes out 5 1/2'. Add some Fairy String Lights for extra scrumptousness! From top to bottom, this is a quality made tree and the extra stabilizers for the base were a special requirement of ours so that event planners and designers can relax, knowing this tree is stable and it's actually pretty easy to scootch around if you want to relocate it. To permanently install it, the base itself has 4 holes so you can secure this tree to the floor. We recommend attaching the stabilizers before assembling the branches. For sensational wedding and event decor, we work hard to get only the best so that you get only the best and our line of decorative flowering trees are exotic and yummy from top to bottom!]]>flowering-trees floral-walls-greenery-backdrops silkflowers artificialgreenerywild-pageexlocu11https://s.yimg.com/aah/shopwildthings/blush-pink-artificial-cherry-blossom-wedding-tree-lifestize-artificial-12.jpghttps://s.yimg.com/aah/shopwildthings/blush-pink-artificial-cherry-blossom-wedding-tree-lifestize-artificial-13.jpgButterfly Garlands or Firefly Fairy Pearl Lights for a dazzling nighttime effect. For special events, create a one-of-a-kind focal point, use as a picturesque photo backdrop or form a floral canopy to provide an elegant setting for wedding ceremonies. For restaurants, stores, hotels or large venues, this tree brings fresh color, height and natural beauty, giving a garden nature feel but because of the height and sideways structure, it takes up minimal space. Add some Fairy String Lights for extra scrumptousness! From top to bottom, this is a quality made tree and the extra stabilizers for the base were a special requirement of ours so that event planners and designers can relax, knowing this tree is stable and it's actually pretty easy to scootch around if you want to relocate it. To permanently install it, the base itself has 4 holes so you can secure this tree to the floor. We recommend attaching the stabilizers before assembling the branches. For sensational wedding and event decor, we work hard to get only the best so that you get only the best and our line of decorative flowering trees are exotic and yummy from top to bottom!]]>flowering-trees floral-walls-greenery-backdrops silkflowers artificialgreenerywild-pageflowering-trees1https://s.yimg.com/aah/shopwildthings/flowering-cherry-blossom-tree-extra-full-6-tall-cream-156.jpghttps://s.yimg.com/aah/shopwildthings/flowering-cherry-blossom-tree-extra-full-6-tall-cream-157.jpgcompletely bendable! Shape it how you'd like and it WILL keep its shape. The base of the 10 main branches is a square metal housing which simply slides into the square holes on the trunk and the look is completely seamless. The branches meld perfectly into the trunk. Very quick and easy! In the center of the base of the top 4 branches there is an area about 1 1/2" in diameter that could easily hold a small bottle of scented oil (like cherry blossom!) or a battery operated DazzLED light! Worried about stability? Well don't. This tree weighs 21.7 lbs. and at the bottom is an 11 3/4" square metal plate. The tree trunk is attached to the base - they are 1 unit that will not come apart. Additionally, the metal base has 4 holes (each 3/4" in diameter) so you can 'permanently' install this tree. It's hard to believe but there are so many branches and blossoms that you could actually remove several of the main stems and use them in a vase and you won't notice them missing from the tree. Seriously, that's just how full it is! Add fairy string lights...OOH! Hang crystal garlands or crystal pendants and ornaments...AHH! You could even expound on the realistic qualities of this tree by placing in a planter box! Around the house this is perfect for a covered patio, sunroom or foyer. For restaurants, stores and hotels, welcome your guests with eye-popping blossoms and celebrate the holidays by decorating with colored LED string lights! If you're planning a large venue, place on a table and make this the grand showpiece of the room! You will be amazed by this elegant blooming beauty and when only the best will do for your event, choose the best with this easy up, pleasing to the eye, exquisite accent piece!]]>catrfatr silkflowers gaandstwild-pagepinks1https://s.yimg.com/aah/shopwildthings/artificial-silk-pink-cherry-tree-lifesize-65.jpghttps://s.yimg.com/aah/shopwildthings/artificial-silk-pink-cherry-tree-lifesize-66.jpgassembling this tree literally takes under 5 minutes! Easy up, easy down, easy transporting and storing! Each main branch consists of 9 smaller branches that are very durable and completely bendable! Shape it how you'd like and it WILL keep its shape. The base of the 10 main branches is a square metal housing which simply slides into the square holes on the trunk and the look is completely seamless. The branches meld perfectly into the trunk. Very quick and easy! In the center of the base of the top 4 branches there is an area about 1 1/2" in diameter that could easily hold a small bottle of scented oil (like cherry blossom!) or a battery operated DazzLED light! Worried about stability? Well don't. This tree weighs 21.7 lbs. and at the bottom is an 11 3/4" square metal plate. The tree trunk is attached to the base - they are 1 unit that will not come apart. Additionally, the metal base has 4 holes (each 3/4" in diameter) so you can 'permanently' install this tree. It's hard to believe but there are so many branches and blossoms that you could actually remove several of the main stems and use them in a vase and you won't notice them missing from the tree. Seriously, that's just how full it is! Add butterfly garlands...OOH! Hang Crystal Garlands, Pendants and Ornaments or hang glass ball candle holders...AHH! You could even expound on the realistic qualities of this tree by placing in a planter box! Around the house this is perfect for a covered patio, sunroom or foyer. For restaurants, stores, hotels and lobbies, welcome your guests with eye-popping blossoms and celebrate the holidays by decorating with LED String Lights! If you're planning a large venue, place on a table and make this the grand showpiece of the room! For sensational wedding and event decor, we work hard to get only the best so that you get only the best and our line of decorative flowering trees are luscious from top to bottom! It's sure hard to beat the beauty of a cherry blossom tree in full bloom so why not enjoy this elegant flowering tree year round!]]>floral-walls-greenery-backdrops silkflowers ropokibawild-pagewhclde1https://s.yimg.com/aah/shopwildthings/flowering-green-and-white-flower-wedding-tree-for-arches-41.jpghttps://s.yimg.com/aah/shopwildthings/flowering-green-and-white-flower-wedding-tree-for-arches-42.jpgFirefly Fairy Pearl Lights for a dazzling nighttime effect. For special events, create a one-of-a-kind focal point, use as a picturesque photo backdrop or form a floral canopy to provide an elegant setting for wedding ceremonies. For restaurants, stores, hotels or large venues, this tree brings color, height, energy and gives a garden feel but because of the height, it takes up minimal space. When placed next to a wall, it comes out 51". Add some Fairy String Lights for extra scrumptousness! The trunk is textured like real bark, with grooves, knots and bumps and the color is spot on! From top to bottom, this is a quality made tree and the extra stabilizers for the base were a special requirement of ours so that event planners and designers can relax, knowing this tree is stable and it's actually pretty easy to scootch around if you want to relocate it. To permanently install it, the base itself has 4 holes so you can secure this tree to the floor. We recommend attaching the stabilizers before assembling the branches. For sensational wedding and event decor, we work hard to get only the best so that you get only the best and our line of decorative flowering trees are exotic and yummy from top to bottom!]]>floral-walls-greenery-backdrops silkflowers ropokibawild-pagewhclde1https://s.yimg.com/aah/shopwildthings/cream-dogwood-flowering-artificial-tree-41.jpghttps://s.yimg.com/aah/shopwildthings/cream-dogwood-flowering-artificial-tree-42.jpgSparkling Crystal Garlands, Pendants or Ornaments only enhances the look and feel of your venue. Around the house this is perfect for a covered patio, sunroom or foyer. For restaurants, stores and hotels, welcome your guests with eye-popping blossoms and celebrate the holidays by decorating with white or colored LED String Lights! If you're planning a large venue, place on a table and make this the grand showpiece of the room! It's sure hard to beat the beauty of a dogwood tree in full bloom so why not enjoy this elegant flowering tree year round! For sensational wedding and event decor, we work hard to get only the best so that you get only the best and our line of decorative flowering trees are yummy from top to bottom!]]>floral-walls-greenery-backdrops silkflowers ropokibawild-pagewhclde1https://s.yimg.com/aah/shopwildthings/flowering-dogwood-tree-ivory-11-feet-tall-sideswept-create-arch-using-2-56.jpghttps://s.yimg.com/aah/shopwildthings/flowering-dogwood-tree-ivory-11-feet-tall-sideswept-create-arch-using-2-57.jpgButterfly Garlands or Firefly Fairy Pearl Lights for a dazzling nighttime effect. For special events, create a one-of-a-kind focal point, use as a picturesque photo backdrop or form a floral canopy to provide an elegant setting for wedding ceremonies. For restaurants, stores, hotels or large venues, this tree brings color, height, energy and gives a garden feel but because of the height, it takes up minimal space. When placed next to a wall, it comes out 5 1/2'. Add some Fairy String Lights for extra scrumptousness! From top to bottom, this is a quality made tree and the extra stabilizers for the base were a special requirement of ours so that event planners and designers can relax, knowing this tree is stable and it's actually pretty easy to scootch around if you want to relocate it. To permanently install it, the base itself has 4 holes so you can secure this tree to the floor. We recommend attaching the stabilizers before assembling the branches. For sensational wedding and event decor, we work hard to get only the best so that you get only the best and our line of decorative flowering trees are exotic and yummy from top to bottom!]]>floral-walls-greenery-backdrops silkflowers ropokibawild-pagewhclde1https://s.yimg.com/aah/shopwildthings/heart-shaped-tree-wedding-decor-white-dogwood-76.jpghttps://s.yimg.com/aah/shopwildthings/heart-shaped-tree-wedding-decor-white-dogwood-77.jpgMake sure to view the video to get the full impact of this tree, which we didn't even take the time to "fluff"! Please note: The shape of the heart in the main photo is exactly how this tree looks. The video is of this tree, EXCEPT now the heart shape in the trunk (the tree you will receive) actually is a true heart shape! For pure romance, it's hard to beat hearts and flowers, just like for top-quality, unique wedding and event decor, it's hard to beat our Flowering Dogwood Tree with a Heart Shaped Trunk and cascading ivory blossoms! This tree is a whopping 12 feet of elegance and it's 8 feet wide! There are 31 main branches, each 40" long, and each main branch has 12 offshoots of fluffy ivory flowers that are 2" in diameter. Very full! The trunk is textured like real bark, with grooves, knots and bumps and the color is spot on! The trunk is attached to a 13 3/4" square metal base with 4 holes to secure to the floor or a platform and you will also receive 4 heavy-duty metal stabilizer plates (each 4 1/4" wide by 14" long) that screw into the base and extend out to provide stability. We recommend attaching the stabilizers before assembling the branches. The trunk pieces and main branches are numbered for easy assembling. The flowered branches are identical and have a metal housing on the end which simply slides into the square holes on the trunk and the look is completely seamless! In 15 minutes, you can assemble this tree and spread out the bendable branches for eye-popping decor! This tree weighs 85lbs. Top quality construction makes our trees an event planners dream and they bring life and energy to any room, are visually pleasing and calming to the soul. Add some butterfly garlands or hang Firefly Fairy Pearl Lights for a dazzling nighttime effect. For special events, create a lovely focal point or use as a picturesque photo backdrop and what a perfect backdrop for a wedding ceremony! For restaurants, stores, hotels or large venues, this tree adds elegance, vitality and gives a romantic garden feel. Add some Fairy String Lights for extra scrumptousness! From top to bottom, this is a quality made tree and the extra stabilizers for the base were a special requirement of ours so that event planners and designers can relax, knowing this tree is stable and it's actually pretty easy to scootch around if you want to relocate it. To permanently install it, the base itself has 4 holes so you can secure this tree to the floor. For sensational wedding and event decor, we work hard to get only the best so that you get only the best and our line of decorative green and flowering trees are exotic and yummy from top to bottom!]]>floral-walls-greenery-backdrops silkflowers ropokibawild-pagepinks1https://s.yimg.com/aah/shopwildthings/flowering-dogwood-cherry-tree-pink-wedding-decor-47.jpghttps://s.yimg.com/aah/shopwildthings/flowering-dogwood-cherry-tree-pink-wedding-decor-48.jpgButterfly Garlands or Firefly Fairy Pearl Lights for a dazzling nighttime effect. For special events, create a one-of-a-kind focal point, use as a picturesque photo backdrop or form a floral canopy to provide an elegant setting for wedding ceremonies. For restaurants, stores, hotels or large venues, this tree brings color, height, energy and gives a garden feel but because of the height, it takes up minimal space. When placed next to a wall, it comes out 5 1/2'. Add some Fairy String Lights for extra scrumptousness! From top to bottom, this is a quality made tree and the extra stabilizers for the base were a special requirement of ours so that event planners and designers can relax, knowing this tree is stable and it's actually pretty easy to scootch around if you want to relocate it. To permanently install it, the base itself has 4 holes so you can secure this tree to the floor. We recommend attaching the stabilizers before assembling the branches. For sensational wedding and event decor, we work hard to get only the best so that you get only the best and our line of decorative flowering trees are exotic and yummy from top to bottom!]]>floral-walls-greenery-backdrops silkflowers ropokibawild-pagepinks11https://s.yimg.com/aah/shopwildthings/flowering-dogwood-tree-pink-heart-shaped-trunk-12-feet-tall-37.jpghttps://s.yimg.com/aah/shopwildthings/flowering-dogwood-tree-pink-heart-shaped-trunk-12-feet-tall-38.jpgMake sure to view the video to get the full impact of this tree. The video is our Dogwood Heart Tree with Ivory Flowers and shows a previous style of trunk. The tree you will receive actually has a true heart shape in the trunk, just like the main photo shown above. For pure romance, it's hard to beat hearts and flowers, just like for top-quality, unique wedding and event decor, it's hard to beat our Flowering Dogwood Tree with a Heart Shaped Trunk and cascading pink blossoms! This tree is a whopping 12 feet of elegance and it's 8 feet wide! There are 31 main branches, each 40" long, and each main branch has 12 offshoots of fluffy pink flowers that are 2" in diameter. Very full! The trunk is textured like real bark, with grooves, knots and bumps and the color is spot on! The trunk is attached to a 13 3/4" square metal base with 4 holes to secure to the floor or a platform and you will also receive 4 heavy-duty metal stabilizer plates (each 2 1/4" wide by 16" long) that screw into the base and extend out to provide stability. We recommend attaching the stabilizers before assembling the branches. The trunk pieces and main branches are numbered for easy assembling. The flowered branches are identical and have a metal housing on the end which simply slides into the square holes on the trunk and the look is completely seamless! In 15 minutes, you can assemble this tree and spread out the bendable branches for eye-popping decor! This tree weighs 85lbs. Top quality construction makes our trees an event planners dream and they bring life and energy to any room, are visually pleasing and calming to the soul. Add some butterfly garlands or hang Firefly Fairy Pearl Lights for a dazzling nighttime effect. For special events, create a lovely focal point or use as a picturesque photo backdrop and what a perfect backdrop for a wedding ceremony! For restaurants, stores, hotels or large venues, this tree adds elegance, vitality and gives a romantic garden feel. Add some Fairy String Lights for extra scrumptousness! From top to bottom, this is a quality made tree and the extra stabilizers for the base were a special requirement of ours so that event planners and designers can relax, knowing this tree is stable and it's actually pretty easy to scootch around if you want to relocate it. To permanently install it, the base itself has 4 holes so you can secure this tree to the floor. For sensational wedding and event decor, we work hard to get only the best so that you get only the best and our line of decorative green and flowering trees are exotic and yummy from top to bottom!]]>floral-walls-greenery-backdrops silkflowers ropokibawild-pageexlocu11https://s.yimg.com/aah/shopwildthings/fuschia-pink-flowering-artificial-tree-lifesize-21.jpghttps://s.yimg.com/aah/shopwildthings/fuschia-pink-flowering-artificial-tree-lifesize-22.jpgButterfly Garlands or Firefly Fairy Pearl Lights for a dazzling nighttime effect. For special events, create a one-of-a-kind focal point, use as a picturesque photo backdrop or form a floral canopy to provide an elegant setting for wedding ceremonies. For restaurants, stores, hotels or large venues, this tree brings fresh color, height and natural beauty, giving a garden nature feel but because of the height and sideways structure, it takes up minimal space. Add some Fairy String Lights for extra scrumptousness! From top to bottom, this is a quality made tree and the extra stabilizers for the base were a special requirement of ours so that event planners and designers can relax, knowing this tree is stable and it's actually pretty easy to scootch around if you want to relocate it. To permanently install it, the base itself has 4 holes so you can secure this tree to the floor. We recommend attaching the stabilizers before assembling the branches. For sensational wedding and event decor, we work hard to get only the best so that you get only the best and our line of decorative flowering trees are exotic and yummy from top to bottom!]]>flowering-trees floral-walls-greenery-backdrops silkflowers artificialgreenerywild-pagesilk-flower-garlands1https://s.yimg.com/aah/shopwildthings/artificial-pink-flower-branch-spray-67.jpghttps://s.yimg.com/aah/shopwildthings/artificial-pink-flower-branch-spray-68.jpgCrystal Beaded Cylinder Vase , fluff the stems to your desired look, stand back and admire! Create breathtaking floral chandeliers or beautify a Ceremony Arch, pipe and drape canopy, trellis, banister or railing. Another accent piece that's quick to decorate and provides sophisticated focal points are Roman Pillar Column Stands which have 4 cut outs on the top plate to insert these long stemmed beauties. Luxury looks don't have to be expensive or hard to achieve. Start with stress-free artificial florals and take pleasure in the time and money you just saved!]]>silkflowers vaflvaeitocy floral-walls-greenery-backdrops flowering-treeswild-pagesilk-flower-garlands1https://s.yimg.com/aah/shopwildthings/artificial-flower-branch-picks-peach-44.jpghttps://s.yimg.com/aah/shopwildthings/artificial-flower-branch-picks-peach-45.jpgWhite Mermaid Vase, fluff the stems to your desired look, stand back and admire! Create breathtaking floral chandeliers or suspend from a Wedding Arch, trellis, pipe and drape canopy, banister or railing. Another accent piece that's quick to decorate and provides sophisticated focal points are Roman Pillar Column Stands which have 4 cut outs on the top plate to insert these long stemmed beauties. Luxury looks don't have to be expensive or hard to achieve. Start with stress-free artificial florals and take pleasure in the time and money you just saved!]]>silkflowers vaflvaeitocy floral-walls-greenery-backdrops flowering-treeswild-pagesilk-flower-garlands1https://s.yimg.com/aah/shopwildthings/white-artificial-flower-branches-60.jpghttps://s.yimg.com/aah/shopwildthings/white-artificial-flower-branches-61.jpgCrystal Beaded Trumpet Vase, fluff the stems to your desired look, stand back and admire! Create a breathtaking overhead floral chandelier or a dreamy floral event canopy by wire tying these branches to a Pipe and Drape Ceremony Gazebo, wedding arch, trellis, banister or railing. Another accent piece that's quick to decorate and provides sophisticated focal points are Roman Pillar Column Stands which have 4 cut outs on the top plate to insert these long stemmed beauties. Luxury looks don't have to be expensive or hard to achieve. Start with stress-free artificial florals and take pleasure in the time and money you just saved!]]>silkflowers vaflvaeitocy floral-walls-greenery-backdrops flowering-treeswild-pageexlocu11https://s.yimg.com/aah/shopwildthings/huge-artificial-floral-canopy-white-wedding-tree-12.jpghttps://s.yimg.com/aah/shopwildthings/huge-artificial-floral-canopy-white-wedding-tree-13.jpgButterfly Garlands, or decorate for holidays and themed events. For special occasions, create a one-of-a-kind focal point, use as a picturesque photo backdrop or form a floral canopy to provide an elegant setting for wedding ceremonies. For restaurants, stores, hotels or large venues, this tree brings freshness, height and natural beauty, giving a garden nature feel. Add some Fairy String Lights for extra scrumptousness! From top to bottom, this is a quality made tree and the extra stabilizers for the base were a special requirement of ours so that event planners and designers can relax, knowing this tree is stable and it's actually pretty easy to scootch around if you want to relocate it. To permanently install it, the base itself has 4 holes so you can secure this tree to the floor. We recommend attaching the stabilizers before assembling the branches. For sensational wedding and event decor, we work hard to get only the best so that you get only the best and our line of decorative flowering trees are exotic and yummy from top to bottom!]]>flowering-trees floral-walls-greenery-backdrops silkflowers artificialgreenerywild-pageexlocu11https://s.yimg.com/aah/shopwildthings/artificial-wisteria-tree-wedding-arch-cream-12.jpghttps://s.yimg.com/aah/shopwildthings/artificial-wisteria-tree-wedding-arch-cream-13.jpgButterfly Garlands or Firefly Fairy Pearl Lights for a dazzling nighttime effect. For special events, create a one-of-a-kind focal point, use as a picturesque photo backdrop or form a floral canopy to provide an elegant setting for wedding ceremonies. For restaurants, stores, hotels or large venues, this tree brings fresh color, height and natural beauty, giving a garden nature feel but because of the height and sideways structure, it takes up minimal space. On this tree it's very easy to add some Fairy String Lights for extra scrumptousness! For sensational wedding and event decor, we work hard to get only the best so that you get only the best and our line of decorative flowering trees are exotic and yummy from top to bottom!]]>flowering-trees floral-walls-greenery-backdrops silkflowers artificialgreenerywild-pageexlocu11https://s.yimg.com/aah/shopwildthings/purple-flowering-wisteria-tree-artificial-lifesize-shopwildthings-12.jpghttps://s.yimg.com/aah/shopwildthings/purple-flowering-wisteria-tree-artificial-lifesize-shopwildthings-13.jpgButterfly Garlands or Firefly Fairy Pearl Lights for a dazzling nighttime effect. For special events, create a one-of-a-kind focal point or use as a picturesque photo backdrop. For restaurants, stores, hotels or large venues, this tree brings fresh color, height and natural beauty, giving a garden nature feel but because of the height and sideways structure, it takes up minimal space. Add some Fairy String Lights for extra scrumptousness! For sensational wedding and event decor, we work hard to get only the best so that you get only the best and our line of decorative flowering trees are exotic and yummy from top to bottom!]]>flowering-trees floral-walls-greenery-backdrops silkflowers artificialgreenerywild-pagetrees-and-floral1jumbo-faux-flowers-with-removable-stemgiant-red-silk-flower-prophuge-flower-props-aisle-decorationsoversized-red-silk-rosesgigantic-silk-roses-removable-stemgiant-pink-silk-flowers-removable-stemjumbo-artificial-pink-roses-with-stemoversize-silk-flower-propsoversized-faux-flower-decorationsjumbo-ivory-silk-rose-propsgiant-silk-flowers-for-propshuge-ivory-silk-roses-removable-stem4pc-silk-rose-flower-wall-set-red4pc-silk-rose-flower-wall-set-white4pc-silk-rose-flower-wall-set-ivory4pc-silk-rose-flower-wall-set-pinkfoam-roses-wall-backdrop4-giant-ivory-real-feel-foam-roseslarge-pink-foam-flowers-wallscapegiant-foam-floating-rose-with-stem-ivory-17inchhuge-white-foam-flower-20inch-wide20inch-wide-giant-foam-flower-ivorypink-floating-roses-2inch-foam-12pcsfoam-floating-pink-roses-3inch-12pcsfloating-foam-roses-pink-100pcsfloating-foam-roses-white-100pcsfloating-foam-roses-ivory-100pcsfloating-foam-roses-coral-100pcsreal-feel-dark-blue-floating-rosesfloating-roses-real-feel-foam-purplefloating-foam-rose-flowers-2inch-ivory-12pcsfloating-foam-roses-3inch-ivorywhite-floating-foam-roses-12pcs-2inchwhite-wedding-roses-3inch-real-feel-foamfloating-foam-rose-stem-white-15inchesfloating-foam-rose-stem-ivory-15inchesmini-rose-set-144pc-white-1inch-foam-flowers1inch-foam-roses-144pc-ivory-wedding-flowerspaper-flower-rose-gardenia-off-white-12inchespaper-flower-rose-gardenia-off-white-14inchespaper-flower-rose-gardenia-off-white-19inchespaper-flower-daisy-off-white-12inchespaper-flower-dahlia-off-white-12inchespaper-flower-cosmos-off-white-11inchessilkflowersbecrcohangingcandlefloral-walls-greenery-backdropsartificialgreeneryropokibagaandstropesiropebsfloral-centerpiece-kitlarge-stem-flower-and-branch-metal-standstand-for-long-stemmed-oversize-faux-flowersfreestanding-flower-wall-frame-metal-setof4large-crown-shaped-floral-foamcraft-floral-foam-large-heart-shapesilk-flower-garlands1https://s.yimg.com/aah/shopwildthings/oversized-flower-party-props-47.jpghttps://s.yimg.com/aah/shopwildthings/oversized-flower-party-props-48.jpgFlower Wall Panels and add some of these to create even more visual interest along the top! Need more matching florals? Be sure to check out our Hanging Floral Garlands which can be used to create a spectacular Floral Ceiling! Need something special for the tabletop? Our Floral Bouquets and Individual Stems are not to be missed.]]>wild-pagefloral-walls-greenery-backdrops11https://s.yimg.com/aah/shopwildthings/free-flower-wall-backdrop-stand-instructions-video-60.jpghttps://s.yimg.com/aah/shopwildthings/free-flower-wall-backdrop-stand-instructions-video-61.jpgScroll down under the video to see your shopping list, instructions, and more photos of this job under construction. Shopping List: Note: Most local lumber stores will make these cuts for you at no charge. There are no complicated angles, making this so easy! • 2 Pcs Plywood 4’ x 8’ 3/8” Thick (backdrop walls)
    • 2 Pcs 2” x 4”’s – Cut to 46 Ľ” Long Each (legs)
    • 2 Pcs 2” x 4”’s – Cut to 24” Long Each (braces in between 2 walls)
    • 2 Pcs 2” x 4”’s – Cut to 6” Long Each (anchors for legs)
    • 1 Pc 2” x 4”’s – Cut to 72” Long Each (center brace for legs)
    • 1 Gallon Green Paint (half gallon may work)
    • 28 Pcs 6” x 1 5/8” Coarse Thread Drywall Screws
    • 12 Pcs 8” x 3” Course Thread Drywall Screws Building Instructions: (PRINT THE PHOTO FOR FIGURES) 1. Lay the (2) 4’ x 8’ Plywood Sheets side by side. – Figure 1 2. Center one 2” x 4” x 24” just below the edge of the top and bottom of the 4 x 8 sheets and trace outline (4 each) – See Figure 2 3. Remove 2” x 4” x 24” – Predrill 1/8” holes evenly in the areas on both sheets – See Figure 2 4. Stand one sheet 4’ x 8’ up. Have an assistant hold (1) 2” x 4” at the top of the traced area, placing half of the 2” x 4” on the plywood 5. Using (4) 6 x 1 5/8” screws, fasten the 2 x 4 to the plywood and repeat at the bottom 6. Match up the other 4’ x 8’ sheet and repeat the previous process. See Figure 4 7. Measure 45” up from the bottom at several points across the plywood. Using a straight edge, mark a line across the plywood. Use this as a guide for the 72” 2x4. Using your mark, center the 2x4 on the Plywood. Trace the outline of the 2x4 and remove. Predrill 1/8” holes (12) evenly spaced. Hold 2x4 back in the traced area and secure with (12) 6 x 1 5/8” screws from the front side. See Figures 5, 6 and 7 8. Place (1) 2”x 4” x 6” at the end of the 72” 2x4 and secure using (4) 8” x 3” screws. Repeat on the other side. See Figure 8 and Photograph 9. Take the (2) 46 Ľ” 2 x 4’s and pre-drill 1/8” hole approximately 2” down and centered at one end. Repeat on the second 2 x 4. See Figure 9 10. With Assistance, stand the wall up almost 90 degrees. Place 46 Ľ” 2x4 with Pre-Drilled Holes up to 2x4 doubles section at the end See Figure 10 11. Secure with (1) 8” x 3” Screw using Pre-drilled 1/8” hole. Re-adjust wall angle (if necessary) and secure with (2) more 8” x 4” screws. Make sure that each screw penetrates the doubled 2x4” Repeat steps 9 through 11 on the opposite side. (see Figures 11, 8, and the Photograph showing this back area) 12. Carefully release wall and observe steadiness and ability to “freestand” There should be a light lean toward the support legs. See Figure 12 13. Optional: For additional support and strength, an anchor line can be attached by drilling a hole on either side approximately 60” up from the bottom. Using a cinderblock or weighted plate – secure a rope line to the back of the wall and adjust tension by moving the block or weight away from the wall. Keep enough tension so the wall will not tip forward. If the wall is used outdoors on a soft surface (i.e. grass or dirt, drill holes in the support legs at the bottom and drive spikes into the ground. See Figure 13 Important: The stability of the structure should be checked after the application of flower panels is complete. Gently and carefully apply pressure from the front and then the rear to make sure that the structure is secure and will not tip over in either direction. See Instruction #13 to add more stability if you’re concerned. The sample Flower Wall that we built in the video was stable on a concrete floor even full of 24 panels of flowers without extra support. To see a larger copy of these drawings below, please scroll to the main images at the top of the page. You can enlarge that image quite a bit and print it. ]]>
    floral-walls-greenery-backdrops artificialgreenery cream-roses-flower-wall-backdrop ivory-floral-backdrop-panel-roses white-rose-hydrangea-flower-wall purple-pink-flower-wall-panels huge-artificial-green-wall-assorted-foliage-40in artificial-ferns-green-wall-panel-fr-20in artificial-greenery-garden-wall-panels faux-boxwood-plant-wall-mat-fr-20in
    wild-pagevispdicrco1https://s.yimg.com/aah/shopwildthings/fringe-string-curtain-columns-up-to-4-feet-wide-x-20-feet-long-dozens-of-color-choices-103.jpghttps://s.yimg.com/aah/shopwildthings/fringe-string-curtain-columns-up-to-4-feet-wide-x-20-feet-long-dozens-of-color-choices-104.jpg1 Foot Diameter String Fringe Column (actual size is 11.25" diameter)
    Item # 999121
    Choose Length from 6 Feet Long to 20 Feet Long
    Choose Fire Treatment Option
    (No Minimum if in-stock curtains are used)
    Prices Start at $55.99 Each - Comes complete with hanging hardware. 2 Foot Diameter String Fringe Column (actual size is 22.50" diameter)
    Item # 999122
    Choose Length from 6 Feet Long to 20 Feet Long
    Choose Fire Treatment Option
    (No Minimum if in-stock curtains are used)
    Prices Start at $98.98 Each - Comes complete with hanging hardware. 3 Foot Diameter String Fringe Column (actual size is 33" diameter)
    Item # 999123
    Choose Length from 6 Feet Long to 20 Feet Long
    Choose Fire Treatment Option
    (No Minimum if in-stock curtains are used)
    Prices Start at $146.97 Each - Comes complete with hanging hardware. 4 Foot Diameter Inch Diameter String Fringe Column (actual size is 44" diameter)
    Item # 999124
    Choose Length from 6 Feet Long to 20 Feet Long
    Choose Fire Treatment Option
    (No Minimum if in-stock curtains are used)
    Prices Start at $184.96 Each - comes complete with hanging hardware. ShopWildThings String Columns are fabricated here in our facility in Lake Havasu City, AZ. They are beautifully constructed of the finest materials and are heavy duty. Our clients find them to be perfect for Retail Spaces, Meeting Spaces, Trade Shows, Event, Weddings, Dances, and just about any special event. There are so many options, but here is what you really need to know: COLUMN DIAMETER: Our custom columns come in 4 widths: 12", 24", 36" and 44". STRING CURTAIN COLORS AND LENGTHS: We stock the most popular colors and sizes so depending on your specific requirements, we can most likely accommodate your order. Please see our In-Stock String Curtain Colors and Sizes. Then, just give us a call at 928.855.6075 so we assist in completing your order. Optionally, click the Contact button at the top of this page and complete the form to send us a quick message. Our helpful team would LOVE to work with you! If we do not have your desired color or length in stock, no problem! Just select your color from our CUSTOM COLOR CHART BELOW. You can also choose to have your columns Fire Treated, as well. Some venues require it. Then please call us at 928.855.6075 to assist with your order and to see if there is a minimum order requirement. To avoid a minimum order requirement, please select an in-stock color. The photos below show String Columns that we made for The Emmy Awards! Your Column will arrive fully constructed and ready to hang. It will include sturdy hanging chains and hardware, which will be attached. You will be able to hang your column in a matter of minutes, making this a perfect item for just about any application. We do the hard work for you. Our string columns are famously soft, beautifully made, and in use around the globe today. Another FABULOUS feature of the columns is that they can be doubled or tripled up, with colors mixed. The inside hanging chain set-up is ready to accept another item on the inside of each ring. You can use a 24" diameter column and hang a 12" diameter column inside! You can use the 44" diameter column and hang a 24" diameter column inside, AND a 12" diameter column inside of that if you like! Mix the colors to add some extra visual interest. To ensure that we get your order just right, we require Custom Orders to be reviewed and confirmed in writing (via email or fax) prior to production. Special Note : Custom Orders are non-refundable, non-returnable, and once production has begun, non-cancellable. Custom Orders do not qualify for Free UPS Ground Shipping, but we only charge our actual negotiated shipping rates. We are also always happy to let you use your shipping account number for any order placed with us.]]>
    stringcurtains customstringcurtains cuch36x4ti crystal-hanging-column-beaded-strands-large-event-decor led-strip-lighting-for-events fatopcuwigr cutopborodsw
    wild-pagesilk-flower-garlands2https://s.yimg.com/aah/shopwildthings/frosted-eucalyptus-spray-2-5-feet-bendable-greenery-stem-26.jpghttps://s.yimg.com/aah/shopwildthings/frosted-eucalyptus-spray-2-5-feet-bendable-greenery-stem-27.jpgThere is a minimum order of 2 sprays. We all love flowers which are an essential element for weddings, special events and everyday decor, but adding greenery enhances any display and completes the visual. Create stylish centerpieces or focal points by placing in Reversible Trumpet Latour Vases along with tall silk sprays. The color of this spray complements soft colors like our Peachy Cream Dogwood Blossom while adding a nice contrast to darker colors like red and purple. Top event planners and designers are taking advantage of every part of their venues by adding overhead floral chandeliers to completely surround guests in luscious natural foliage and this spray is an ideal addition for lavish draping designs. Using a 2-Tier Display Frame, dangle flowers and greenery to create suspended floral magic! The long stalk can easily be attached to frames and structures like a wedding arch or trellis. Since our Roman Pillar Columns have 4 small cutouts on the top plate, this spray is an effortless addition while providing height and uniqueness.]]>clear-acrylic-wedding-arch-backdrop artificialgreenery faux-eucalyptus-leaves-spray silk-eucalyptus-branch-bendable-spray silkflowers vaflvaeitocywild-pagefeosfe2https://s.yimg.com/aah/shopwildthings/fuchsia-ostrich-feathers-13-15-spads-61.jpghttps://s.yimg.com/aah/shopwildthings/fuchsia-ostrich-feathers-13-15-spads-62.jpgThere is a minimum order of 2 feathers. Simply place them on a table or in vases, combine with floral Decor, bouquets and wreaths, cards, invitations and gifts, decorate hats and costumes. Feathers are just fun and our colorful ostrich feathers dyed in exciting and vibrant colors are ready to display! These are real feathers (not man-made), so not every feather is identical in shape - they will vary from 13" - 15" in length and the width or spread of the feathers tend to run about 6" - 7". They are sold as each so you will get 1 feather. Because of frequent damage in return shipping, we regret that this item is not returnable]]>feosfe vaflvaeitocy acledevlifluwild-pagefeosfe1https://s.yimg.com/aah/shopwildthings/fuchsia-pink-ostrich-feathers-29-32-spads-52.jpghttps://s.yimg.com/aah/shopwildthings/fuchsia-pink-ostrich-feathers-29-32-spads-53.jpgBecause of frequent damage in return shipping, we regret that this item is not returnable]]>feosfewild-page3dglorlahade11https://s.yimg.com/aah/shopwildthings/galvanized-metal-folding-ball-silver-12-31.jpghttps://s.yimg.com/aah/shopwildthings/galvanized-metal-folding-ball-silver-12-32.jpgGreenery Garlands and touches of colorful flowers draping from the sides. For a more compact look, Succulents with burlap and moss are perfect elements to enhance the ball. Easy to hang, great for a table, patio or garden, this wonderful accent piece will quickly become one of your favorite design elements! We offer various sizes of this galvanized metal sphere or mix up the look by pairing with our wrought iron folding balls that have a patina finish or our wrought iron folding balls with an antique brown finish. All complement each other very nicely and make an interesting focal point when you hang several in a vertical row, mixing the sizes and colors! The video below shows a similar product that we carry that comes in a set of three, but this item folds flat just like those in the video. So handy!]]>wimeceit artificialgreenery silk-flower-garlandswild-page3dglorlahade11https://s.yimg.com/aah/shopwildthings/galvanized-metal-folding-ball-silver-18-12.jpghttps://s.yimg.com/aah/shopwildthings/galvanized-metal-folding-ball-silver-18-13.jpgGreenery Garlands and touches of colorful flowers draping from the sides. For a more compact look, Succulents with burlap and moss are perfect elements to enhance the ball. Easy to hang, great for a table, patio or garden, this wonderful accent piece will quickly become one of your favorite design elements! We offer various sizes of this galvanized metal sphere or mix up the look by pairing with our wrought iron folding balls that have a patina finish or our wrought iron folding balls with an antique brown finish. All complement each other very nicely and make an interesting focal point when you hang several in a vertical row, mixing the sizes and colors! The video below shows a similar product that we carry that comes in a set of three, but this item folds flat just like those in the video. So handy!]]>wimeceit artificialgreenery silk-flower-garlandswild-page3dglorlahade11https://s.yimg.com/aah/shopwildthings/galvanized-metal-folding-ball-silver-24-12.jpghttps://s.yimg.com/aah/shopwildthings/galvanized-metal-folding-ball-silver-24-13.jpgGreenery Garlands and touches of colorful flowers draping from the sides. For a more compact look, Succulents with burlap and moss are perfect elements to enhance the ball. Easy to hang, great for a table, patio or garden, this wonderful accent piece will quickly become one of your favorite design elements! We offer various sizes of this galvanized metal sphere or mix up the look by pairing with our wrought iron folding balls that have a patina finish or our wrought iron folding balls with an antique brown finish. All complement each other very nicely and make an interesting focal point when you hang several in a vertical row, mixing the sizes and colors! The video below shows a similar product that we carry that comes in a set of three, but this item folds flat just like those in the video. So handy!]]>wimeceit artificialgreenery silk-flower-garlandswild-page3dglorlahade11https://s.yimg.com/aah/shopwildthings/galvanized-metal-folding-ball-silver-8-11.jpghttps://s.yimg.com/aah/shopwildthings/galvanized-metal-folding-ball-silver-8-12.jpgGreenery Garlands and touches of colorful flowers draping from the sides. For a more compact look, Succulents with burlap and moss are perfect elements to enhance the ball. Easy to hang, great for a table, patio or garden, this wonderful accent piece will quickly become one of your favorite design elements! We offer various sizes of this galvanized metal sphere or mix up the look by pairing with our wrought iron folding balls that have a patina finish or our wrought iron folding balls with an antique brown finish. All complement each other very nicely and make an interesting focal point when you hang several in a vertical row, mixing the sizes and colors! The video below shows a similar product that we carry that comes in a set of three, but this item folds flat just like those in the video. So handy! ]]>wimeceit artificialgreenery silk-flower-garlandswild-pagefuforhoandev1https://s.yimg.com/aah/shopwildthings/garden-stool-liang-black-69.jpghttps://s.yimg.com/aah/shopwildthings/garden-stool-liang-black-70.jpgWe regret that this oversized item does not qualify for the FREE SHIPPING offer. Please select the shipping method "Truck Freight - Complete Your Order, We Will Call You". We will get a Freight Quote for you right away and contact you with that information. Go ahead and submit your order online or call us on the phone at 928-855-6075. We will take care of getting the information that you need to complete your order as quickly as we can. We had to set this item up this way because the shipping varied too much across the country to have a "set price" that we felt was fair to all regions. This will allow us to charge exactly what we are charged instead of "close enough". Garden Stools are becoming more and more popular for use in both homes and events. In the home, a Ceramic Garden Stool might be used near the patio to hold supplies, drinks and more. Indoors they can be used to fill space where you need "just a little something", a splash of color, or something functional like an end table next to a chair or couch. Tuck a couple underneath of an entryway table to fill up that awkward space. Garden Stools are as much a piece of art for your home as they are functional. Our beautiful Ceramic garden stools are handmade, painted, and kiln fired. We inspect each and every one before it ships. Due to the handmade nature of this item, slight variations may occur. Apartment Therapy offered this fantastic article about the history of garden stools: "For the last few years, barrel-shaped ceramic stools have been a popular decorating accessory, adding luster, color or texture to a space while serving as little side tables or room accents. But where do they come from, and where were they traditionally used? Okay, the answer is in the title of the post: they come from China, and they were traditionally used in gardens. But read on to learn more about the fascinating origins of this familiar form. Believe it or not, barrel- or drum-shaped garden stools have been used in China for at least 1,000 years. They may have evolved out of the Buddhist garden tradition, where natural elements like tree stumps and smooth rocks were used as seats. Traditionally, Chinese homes were build around a courtyard, and with an emphasis on landscape and gardens, so outdoor furniture was essential. By the Song Dynasty (960-1279), these types of stools were used both indoors and outdoors as casual seating . Indoor stools were typically portable and made out of wood, while outdoor furniture, needing to withstand the elements, began to be made out of stone, glazed stoneware , or porcelain . The antique stools that are still extant tend to be from the late Ming Dynasty Ń early 17th century Ń and later, and they have a range of decoration, including fretwork, relief decoration, and pierced motifs. One common decoration is simulated nailheads, often around the upper and lower parts of the barrel form. The nailhead motif is left over from ancient Chinese drums, which had wood bodies with skins stretched over each end and affixed with nails. Although these ceramic drum-shaped stools have been exported to the West for about 300 years, it is only since the mid-20th century that they have gained such currency in American interiors Ń and exteriors .]]>fuforhoandevwild-pagefuforhoandev1https://s.yimg.com/aah/shopwildthings/garden-stool-sonoma-purple-lattice-59.jpghttps://s.yimg.com/aah/shopwildthings/garden-stool-sonoma-purple-lattice-60.jpgWe regret that this oversized item does not qualify for the FREE SHIPPING offer. Please select the shipping method "Truck Freight - Complete Your Order, We Will Call You". We will get a Freight Quote for you right away and contact you with that information. Go ahead and submit your order online or call us on the phone at 928-855-6075. We will take care of getting the information that you need to complete your order as quickly as we can. We had to set this item up this way because the shipping varied too much across the country to have a "set price" that we felt was fair to all regions. This will allow us to charge exactly what we are charged instead of "close enough". The room photo shows a similar stool in a black finish.]]>fuforhoandevwild-pagewhclde1https://s.yimg.com/aah/shopwildthings/garland-vonda-clear-60-strand-of-chunky-acrylic-gems-42.jpghttps://s.yimg.com/aah/shopwildthings/garland-vonda-clear-60-strand-of-chunky-acrylic-gems-43.jpgThis cool new clear garland is made up of some great looking chunky beads that alternate in size, giving great visual appeal. Each bead is faceted so that it catches the light nicely. This garland features beads strung onto metal wire, giving it extra durability and a great look. The end of each strand is finished with a beautiful large 2.5" Long pendant. Total length of strand 60"gaandstwild-pagebudeitbugach1https://s.yimg.com/aah/shopwildthings/garland-butterfly-dark-royals-w-glitter-40.jpghttps://s.yimg.com/aah/shopwildthings/garland-butterfly-dark-royals-w-glitter-41.jpgThis vibrant colors of this AMAZING butterfly strand are only rivaled by the wings which are real feathers! The feather wings alternate from dark blue to royal blue and they are ornamentally decorated with dark blue, fuchsia and turquoise glitter. The underside of the wings have a thin coating which holds the feathers in place. The strand is 6.5' long and each butterfly has a wingspan of 6" wide by 3.5" long. They are evenly spaced along the monofiliment strand and there is a loop at the top of the garland and a clear, faceted bead at the bottom. The colors on these 9 butterflies are exquisite!triangle-pennant-bunting-banner-garlands-butterflies-hearts catrfatr gaandstwild-pagebudeitbugach1https://s.yimg.com/aah/shopwildthings/garland-nine-piece-butterfly-pink-glitter-39.jpghttps://s.yimg.com/aah/shopwildthings/garland-nine-piece-butterfly-pink-glitter-40.jpgThis splendid butterfly strand is AMAZING! The wings of this spectacular beauty are actual, real feathers! These fuchsia feathers have been ornately decorated with silver and fuchsia glitter - gorgeous enough to rival a real butterfly! The underside of the wings have a thin coating which holds the feathers in place. The strand is 6.5' long and each butterfly has a wingspan of 5.5" wide by 3" long. They are evenly spaced along the monofiliment strand and there is a loop at the top of the garland and a clear, faceted bead at the bottom. These colors are so vivid and cheerful on these 9 butterflies that you'll want to immediately take them out, hang them and enjoy this glistening, graceful strand!triangle-pennant-bunting-banner-garlands-butterflies-hearts catrfatr gaandstwild-pagehebecu1https://s.yimg.com/aah/shopwildthings/garland-paper-3d-hearts-pink-glitter-44.jpghttps://s.yimg.com/aah/shopwildthings/garland-paper-3d-hearts-pink-glitter-45.jpgpink-glitter-paper-triangle-buntings budeitbugach catrfatr gaandstwild-pageracost1https://s.yimg.com/aah/shopwildthings/garland-butterflies-colorful-primaries-6-5-feet-long-58.jpghttps://s.yimg.com/aah/shopwildthings/garland-butterflies-colorful-primaries-6-5-feet-long-59.jpgThese adorable butterflies made from real feathers will add life and color wherever they are placed and the hand painted features on the feather wings is to be admired! The wing colors are light yellow, orange, fuchsia, turquoise or red and have contrasting lines and colors for that extra detail! The underside of the wings have a thin coating which holds the feathers in place. The strand has 9 butterflies and is 6.5' long. Each butterfly has a wingspan of 4" wide by 2.5" long. They are evenly spaced along the monofiliment strand and there is a loop at the top of the garland and a clear, faceted bead at the bottom.triangle-pennant-bunting-banner-garlands-butterflies-hearts catrfatr gaandstwild-pageracost1https://s.yimg.com/aah/shopwildthings/garland-butterflies-royal-multicolors-6-5-feet-long-57.jpghttps://s.yimg.com/aah/shopwildthings/garland-butterflies-royal-multicolors-6-5-feet-long-58.jpgThe colors really pop on these gorgeous butterflies and an incredible feature is that the wings are real feathers! The wing colors are light yellow, orange, fuchsia, purple or red and are hand painted with contrasting lines and colors. The underside of the wings have a thin coating which holds the feathers in place. The strand has 9 butterflies and is 6.5' long. Each butterfly has a wingspan of 5.5" wide by 2.5" long. They are evenly spaced along the monofiliment strand and there is a loop at the top of the garland and a clear, faceted bead at the bottom. The detail on these awesome butterflies is remarkable.triangle-pennant-bunting-banner-garlands-butterflies-hearts catrfatr gaandstwild-pagewhclde1https://s.yimg.com/aah/shopwildthings/garland-6-clear-crystal-beads-silver-wire-30.jpghttps://s.yimg.com/aah/shopwildthings/garland-6-clear-crystal-beads-silver-wire-31.jpg5' 6" Crystal Beaded Garland on Thin Silver Wire, Tree, Floral and Table Decoration Use this stunning garland to wrap around candle holders, to enhance floral displays or simply use as sparkling tree garland. Hundreds of crystal clear beads are hand- strung onto bendable silver wire and the crystal covered portion of the garland is 58" long with an additional 8" long plain wire to wrap and secure the garland. Varying length strands sprout from both sides of the main wire for an approx. width of 7", or position the wires in an upright position. Hang in front of a window or mirror for a beautiful, icy effect or use in a table centerpiece or as a table runner.gaandstwild-pagegaandst1https://s.yimg.com/aah/shopwildthings/garland-pearls-on-wire-60-strand-of-pearls-and-acrylic-gems-62.jpghttps://s.yimg.com/aah/shopwildthings/garland-pearls-on-wire-60-strand-of-pearls-and-acrylic-gems-63.jpgOur fantastic new pearl garland is strung on wire for an extra-upscale look. You'll love all of the different sizes of large pearls, ranging in size from 1/4" to 3/4" in diameter! Among the pearl beads you'll find some very cool square clear acrylic beads. The end of each strand is finished with a large faceted acrylic drop that is 2" long. Total length 60"floralspraypearls jbabecu 10004 pearlstickers6mm pearlwraprollwild-pagesilverdecor1https://s.yimg.com/aah/shopwildthings/garland-5-feet-long-metallic-silver-pearls-set-of-2-48.jpghttps://s.yimg.com/aah/shopwildthings/garland-5-feet-long-metallic-silver-pearls-set-of-2-49.jpg]]>goldbeadedgarlandstrand gaandst brandspwild-pagegolddecor11https://s.yimg.com/aah/shopwildthings/garland-5-feet-long-pack-of-2-gold-brown-pearl-34.jpghttps://s.yimg.com/aah/shopwildthings/garland-5-feet-long-pack-of-2-gold-brown-pearl-35.jpg ]]>wild-pagegaandst11https://s.yimg.com/aah/shopwildthings/garland-5-feet-long-set-of-2-clear-clear-49.jpghttps://s.yimg.com/aah/shopwildthings/garland-5-feet-long-set-of-2-clear-clear-50.jpg ]]>glcaho27tatrwild-pagegaandst11https://s.yimg.com/aah/shopwildthings/garland-5-feet-long-set-of-2-blue-and-green-35.jpghttps://s.yimg.com/aah/shopwildthings/garland-5-feet-long-set-of-2-blue-and-green-36.jpg ]]>wild-pagegaandst11https://s.yimg.com/aah/shopwildthings/garland-5-feet-long-set-of-2-blue-mist-37.jpghttps://s.yimg.com/aah/shopwildthings/garland-5-feet-long-set-of-2-blue-mist-38.jpg]]>wild-pagegaandst11https://s.yimg.com/aah/shopwildthings/garland-5-feet-long-set-of-2-chocolate-36.jpghttps://s.yimg.com/aah/shopwildthings/garland-5-feet-long-set-of-2-chocolate-37.jpg]]>wild-pagegaandst11https://s.yimg.com/aah/shopwildthings/garland-5-feet-long-set-of-2-ivory-pearl-stones-pearls-38.jpghttps://s.yimg.com/aah/shopwildthings/garland-5-feet-long-set-of-2-ivory-pearl-stones-pearls-39.jpg ]]>wild-pagegaandst11https://s.yimg.com/aah/shopwildthings/garland-5-feet-long-set-of-2-lavender-mist-35.jpghttps://s.yimg.com/aah/shopwildthings/garland-5-feet-long-set-of-2-lavender-mist-36.jpg ]]>wild-pagegaandst11https://s.yimg.com/aah/shopwildthings/garland-5-feet-long-set-of-2-moonstone-white-35.jpghttps://s.yimg.com/aah/shopwildthings/garland-5-feet-long-set-of-2-moonstone-white-36.jpg ]]>wild-pagegaandst11https://s.yimg.com/aah/shopwildthings/garland-5-feet-long-set-of-2-orange-35.jpghttps://s.yimg.com/aah/shopwildthings/garland-5-feet-long-set-of-2-orange-36.jpg ]]>wild-pagegaandst11https://s.yimg.com/aah/shopwildthings/garland-5-feet-long-set-of-2-pearls-garnet-red-iridescent-36.jpghttps://s.yimg.com/aah/shopwildthings/garland-5-feet-long-set-of-2-pearls-garnet-red-iridescent-37.jpg ]]>wild-pagereddecor11https://s.yimg.com/aah/shopwildthings/garland-5-feet-long-set-of-2-red-2-toned-49.jpghttps://s.yimg.com/aah/shopwildthings/garland-5-feet-long-set-of-2-red-2-toned-50.jpg]]>trinpo3fetab1 chorbecoevwild-pagegaandst11https://s.yimg.com/aah/shopwildthings/garland-5-feet-long-set-of-2-topaz-pearlized-and-iridescent-34.jpghttps://s.yimg.com/aah/shopwildthings/garland-5-feet-long-set-of-2-topaz-pearlized-and-iridescent-35.jpg ]]>wild-pagewhclde11https://s.yimg.com/aah/shopwildthings/garland-5-feet-long-set-of-2-white-pearl-beaded-35.jpghttps://s.yimg.com/aah/shopwildthings/garland-5-feet-long-set-of-2-white-pearl-beaded-36.jpg ]]>wild-pagegaandst1https://s.yimg.com/aah/shopwildthings/garland-5-feet-long-soft-metallic-gold-pearls-set-of-2-49.jpghttps://s.yimg.com/aah/shopwildthings/garland-5-feet-long-soft-metallic-gold-pearls-set-of-2-50.jpg]]>silverbeadedgarlandstrand gaandst brandspwild-pagesilkflowersk9-crystal-beaded-garland-strand-small-beadk9-crystal-beaded-garland-strand-large-beadreal-crystal-30foot-garland-strand30foloclbest30fololaocga7010030foloovocac30foloffaova30foloaofdiacirclesandsquaresacrylicsquaresemeraldsandsquaresacrylicgarlandreal-glass-crystal-strand-wedding-trees-hawthorn70102froacbagast6circlesacryliccrystalgarlands70106tree-crystals-clear-real-glass-octagons-dinsmorecrystalstrandoctagonscrystalstrandiridescentcrga4fe3coavacgastro1doscleargarlands70104crystalgarlandscirclesglass-crystals-real-glass-squares-baxtoncrystal-prism-strand-set-clear-20inchesacpe4lodsetocrystal-prism-set-of-12-strandsreal-crystal-garland-ornamentcrystal-strand-with-pendant-silverclear-hanging-raindrop-ornamentswedding-tree-crystal-decorationscrystal-hanging-prisms-glass-12pcsglass-crystal-bead-strands-silver-prismsclear-hanging-kite-ornament-setslarge-crystal-hanging-ornamentsreal-crystal-beads-strands-ornamentscrystal-prism-iridescent-strand-setclear-teardrop-beads-hangingreal-crystal-garlands-elizabeth-cleariridescent-real-crystal-garlands-elizabethreal-glass-crystal-garland-silverbutterfly-crystal-strands-real-crystalreal-glass-ball-faceted-crystal-oranamentacgastoc1doslaciandocacgmirror-garland-strand-round-discs-33feetmirror-garland-chain-double-density-circles-33ftmirror-garland-strand-rectangles-33feetmirror-garland-strand-squares-33feetlarge-beaded-black-acrylic-garland-30ftcrystal-clear-beaded-garland-30ftacrylic-garland-strands-12-pcs-fuchsiaacrylic-garland-strands-12-pcs-light-blue1900230fololajetb190031900519004acrylic-black-beaded-garland-strandbrowncrystalgarlandacgastlipidiacgastpuro1dacgastpudi1dacgastfuro1dacgastfudi1dacgastblro1dacgastbldi1dacgastturo1dacgasttudi1dglass-ball-strand-silver-22-inchesglass-teardrop-strand-champagne-22-inchesglass-teardrop-strand-clear-22-inchesglass-teardrop-strand-silver-22-inchespearlgarlandsrolls-of-pearl-beads-crafts-whiterollofpearlsrolls-of-pearl-beads-crafts-ivoryroll-of-pearls-ivory-10mm-66feetdisco-ball-roll-of-beadsroofbe66diduroofbe33ya9droofbe33ya9d2roofbe33ya9froofbe33ya9d1roofbe22ya6dcrystal-beads-roll-iridescent-6mm-ballchainroofbe22ya61roofbe50yadi1roofbe50yaliroofbe60gecr20yds-iridescent-roll-of-beadsroofbe33ya1broofbe33ya99hanging-crystal-balls-clear-12pcs-20mmcrystal-clear-30mm-hanging-ball-dropsfaceted-crystal-balls-40mm-clear-dropslarge-faceted-crystal-ball-pendant-50mm-clearcrystalbeadedgarlandga5felowhbega5felosetof14ga5felosetof12ga5felosetof1ga5felosetof11ga5felosetof5ga5felosetof15ga5felosetof2ga5felopaof25ga5felosetof9ga5felosetof8ga5felosetof17ga5felosetof6ga5felogrpesgaofgl5felopsilverbeadedgarlandstrandgoldbeadedgarlandstrandga5felosetofbecari4pecridiamondbeadremnants272feetaces-eights-crystal-bead-strandsballchain-silver-bead-remnant-strands-12footremnant-bead-strands-crafts-decorations1ballchain-crystal-iridescent-remnantspastel-gypsy-bead-remnantsdriftwood-garland-whitewashed-84inchesdriftwood-garland-natural-84incheswood-slab-garland-faith-hope-love-wooden-slicesdriftwood-garland-with-stonesdrga72drga72lox3mpbirch-ribbon-70inchesbugaglblfubaaqua-silk-roses-flower-garland-8ftcoral-silk-roses-flower-garland-8ftpink-silk-roses-flower-garland-8ftpurple-silk-roses-flower-garland-8ftroyalblue-silk-roses-flower-garland-8ftred-silk-roses-flower-garland-8ftwhite-silk-roses-flower-garland-8ftplumeria-flower-garland-cream-86inchesplumeria-flower-garland-cream-and-pink-91inchesplumeria-garland-cream-double-sided-76inchesplumeria-flower-garland-white-80inches5foot-capiz-shell-strands-magentasparkle-garland-gold-silver-chaintissue-paper-tassel-garlands-8pcs-12inch-whitetissue-paper-tassel-garlands-8pcs-12inch-blackugludaoaaddaugldamaanst11https://s.yimg.com/aah/shopwildthings/beaded-garlands-strands-39.jpghttps://s.yimg.com/aah/shopwildthings/beaded-garlands-strands-40.jpgrolls of beads and beaded pendants that are the perfect garland accompaniments. Plus, everyone who has given us their feedback has one important thing in common: they rave about the quality and how amazing they look.

    We have a large inventory of crystal beads that is ready to ship to you quickly and in time for your special event. If you do not see what you are looking for on this page, please call us. One of our professional, knowledgeable team members will be happy to help you find the perfect crystal strands for you.

    ugludaoaadda peacgl chorbecoev catrfatr digoorhoseto disiorhoseto rollsofbeads brandsp budeitbugach 70103 centerpiece-topper-crystal-beaded orstsetof69t orstsetof614 acrylic-vs-crystal-beads
    Decorate stage sets, outdoor festivals, wedding receptions, bridal showers, birthday parties and anniversary celebrations. Add dazzle to retail window displays or nightclub entrances. Transform an ordinary deck into the setting for a fabulous cocktail party.

    Choose our octagon clear beads that are faceted to look like diamonds. Let them cascade from railings, centerpieces or candleholders. To Decorate a wedding tree, one of our customers, a leading event planner, draped the tree with strands of diamond-cut acrylic crystal strands clear crystal acrylic hanging pendants.

    We also carry crystal garlands in your choice of clear, red, blue, jet black, pink or purple acrylic beads. Create a solid color theme, or create a mix of colors.

    Our collections of acrylic pendants have been purchased for use at formal parties and to Decorate bedrooms in private homes. Each is faceted to produce a prism effect that catches and reflects light. Hang them from wedding arches, centerpieces, candleholders or light fixtures.

    Our raindrop-shaped "Miranda" acrylic pendants are available in sets of 24 to hang from wedding trees or chandeliers. Choose tiny clear pendants or larger acrylic pendants in sizes ranging up to 2 inches in diameter. Our real-glass icicle hanging ornaments range in length from 4.75 to 7 inches. Create a special effect with 7.5-inch teardrop ornaments.

    We carry charming diamond ring-shaped hanging ornaments and faux mercury glass drop ornaments in antique silver and gold. Choose an elegant pendant with our hanging fleur-de-lis ornaments in silver glitter or gold and champagne glitter. Decorate a centerpiece or entryway with our gold or silver glitter hanging candelabra ornament. It's 16 inches high.

    Go retro with our shiny silver hanging disco ball ornaments. You can also order our acrylic crystal pendants available in more than a dozen sheer colors by the 130-piece bag.

    • Roll of beads and diamond wrap are great for DIY weddings and special events
    • Adjusting the size of crystal garlands and strands is a snap because they're made with removable jump rings
    • Crystal pendants are constructed from high-quality acrylic material
    • Our Decorative glass balls come in three different sizes: 60 millimeter, 80 millimeter and 100 millimeter
    Need a large rush order? No Problem. We have over 200,000 items in stock and we'll get it to you FAST!
    wild-pageacbecu11https://s.yimg.com/aah/shopwildthings/gemstone-crystal-beaded-curtain-3-x-6-74.jpghttps://s.yimg.com/aah/shopwildthings/gemstone-crystal-beaded-curtain-3-x-6-75.jpg]]>crch ripege roofbe60gecr gecrbecu3x24wild-pageacbecu11https://s.yimg.com/aah/shopwildthings/gemstones-green-blue-beaded-curtain-34.jpghttps://s.yimg.com/aah/shopwildthings/gemstones-green-blue-beaded-curtain-35.jpgThis curtain matches our "Madison" Chandelier in the Crystal Color!]]>hacahotembll quwipompotua ligrniwild-pageacbecu11https://s.yimg.com/aah/shopwildthings/gemstone-curtain-purples-beaded-curtain-31.jpghttps://s.yimg.com/aah/shopwildthings/gemstone-curtain-purples-beaded-curtain-32.jpgThis curtain matches our "Madison" Chandelier!]]>wild-pagegemstones11https://s.yimg.com/aah/shopwildthings/gemstone-crystal-beaded-curtain-3-wide-x-12-feet-long-28.jpghttps://s.yimg.com/aah/shopwildthings/gemstone-crystal-beaded-curtain-3-wide-x-12-feet-long-29.jpgOur exquisite new gemstone beaded curtain is the result of many many many requests for a "chunkier jewel" set of door beads. 24 strands of beads hang 12 feet long from one 3 foot wide rod. You just take it out of the box and hang it right up....and you'll be giving new life to your space! This is the heaviest curtain we carry. It has tons of great detail with the faceted beads in various gemstone cuts. WE KEEP HUNDREDS OF CURTAINS IN STOCK FOR IMMEDIATE DELIVERY! On this style of curtain, the hanging hardware (the metal eyelets at the top) slide back and forth on the rod making it the PERFECT curtain to alter in width! So if you need to cover a space that's 47" wide, you would use two of this curtain. Just cut the second curtain down and hang it next to the first curtain. This will look like you've got just one perfect curtain hanging up! 3" Wide x 12 Feet Long: Our wonderful heavy-duty acrylic beaded curtains are a perfect addition to any room! Use in the place of regular doors, closet doors, or behind a bed to add the look of height to any room! This clear curtain has an iridescent finish. 24 strands of B-E-A-utiful! Each highly faceted bead is 1.5cm in diameter. All beads are attached, just hang it right up using two nails or two small c-hooks. Strand Count: 24 Strands Per Curtain! We recommend hanging the curtain in place (full length) before removing the ties from the strands. To store your beaded curtains, tie the curtain into sections of strands before taking it down and putting it back in the box. This will make your life SO much easier at events!gecrbecu3x18 gecucr crch roofbe60gecr ewawasubr60lwild-pageaccusobystgecucr190921909519094gecrbecu3wixgecupugecubrligebecupiligebecucrligebecupugegrblbecuch6felocrlgepuchcrchroofbe50yaliroofbe60gecr1https://s.yimg.com/aah/shopwildthings/gemstones-beaded-curtains-4-colors-long-lengths-available-57.jpghttps://s.yimg.com/aah/shopwildthings/gemstones-beaded-curtains-4-colors-long-lengths-available-58.jpg Our Gemstone crystal bead curtains at ShopWildThings have generous strands of large acrylic gemstone-cut beads that will add sparkle to any special event or production stage. Add dazzle to a bedroom, outdoor celebration or retail window display. We've got gorgeous gemstone-facet acrylic crystal chandeliers, too, for that next grand gala. Our Gemstones curtains, chandeliers and beads by the roll each have three sizes of beads. The Little Gems style comes with 4mm, 6mm and 10mm faceted beads and the regular gemstone style comes with 4mm, 10mm and 15mm (.59 inch). Mix and match the different sizes of curtains and chandeliers with 4mm, 6mm and 10mm (.39 inch) beads. Our Acrylic Beaded Curtains come fully assembled on a 35" wide rod.]]>curtainhookswild-pagerewophonmtv11https://s.yimg.com/aah/shopwildthings/general-hospital-set-decor-brilliant-square-crystal-columns-27.jpghttps://s.yimg.com/aah/shopwildthings/general-hospital-set-decor-brilliant-square-crystal-columns-28.jpgJennifer Elliot, set Decorator for ABC's General Hospital LOVES ShopWildThings! She was kind enough to share this fabulous set design photo where our Brilliant Square Shaped Crystal Columns were used to create a wonderful Valentine's Party Scene for the show. They look so amazing in this awesome room!14footcrystalcolumnsquare 9footcrystalcolumnsquare 20footcrystalcolumnsquarewild-pageshellcurtains1https://s.yimg.com/aah/shopwildthings/genuine-capiz-shell-curtain-white-adjustable-length-86.jpghttps://s.yimg.com/aah/shopwildthings/genuine-capiz-shell-curtain-white-adjustable-length-87.jpgPLEASE NOTE: The head rail is black, not brown as shown. Photo will be updated shortly. These genuine white capiz shell adjustable-length beaded curtains from ShopWildThings are the same capiz shell curtains used by Sandals Beach Resorts for their outdoor wedding pavilions. They will add tropical flair to your home or special event. Because they're made of shells and metal jump rings, they're naturally fireproof.

    Each capiz shell curtain is 35.5 inches wide and 72 inches long with 12 strands of delicate pearlescent white natural capiz shells, which also are called windowpane oyster shells. Each shell is about 2 inches in diameter. A hole is at the top and bottom to connect each shell with a jump ring. This makes it easy to change the number of strands or add more capiz curtains.

    To see how easy it is to hang our beaded curtains, watch our how-to video on this page. The black wooden rod at the top of our genuine capiz shells curtain has two metal eyelets. Simply hang the two eyelets over two nails, or use our popular curtain hanging c-hooks.

    These are great buys for weddings, posh retail spaces, beach cottages and homes. One customer purchased a curtain for a room, adjusted the length and used the extra, shorter strands to create a unique window valance. For more decorating inspiration, click on our Decor Photos ; Ideas page. Our beaded curtain customers include Universal Pictures, Disney theme parks, MGM Studios, HBO, Sony Pictures and top commercial television networks.

    capiz-chandelier-real-shells-2feet secashla14x1 curtainhooks shellcurtains
    Rather than a solid vase, the airy look of terrariums make them a popular vessel for showcasing succulents, florals, candles and string lights. Another plus is that you can see the contents from all sides (even the bottom) making it an ideal centerpiece focal point.

    This terrarium is 5" tall by 5" wide and the opening is also 5" by 5". This glass cube has a triangle pane on one corner so you can place the terrarium on a square side or flip it on the triangle, making an attractive and intriguing display! Use as a vase to hold natural materials like sand, pearls, shells and greenery like moss, ivy and succulents. Foam Roses and Colorful Rose Petals look awesome and there's no mess or fuss! Use as a candle holder with Flameless LED Tea Lights, Votive Candles or Warm White Fairy String Lights. Lights and a touch of greenery look exceptionally chic in terrariums and it's a quick and easy combination that really looks awesome! Use U GLU Adhesive Dots to help keep materials in place.

    Plants are calming and comforting, lights are warming and welcoming. Combine both inside this geometric terrarium for an innovative, inviting and appealing display!]]>
    getecaho flledcabaop succulents-for-events silkflowers
    Rather than a solid vase, the airy look of terrariums make them a popular vessel for showcasing succulents, florals, candles and string lights. Another plus is that you can see the contents from all sides (even the bottom) making it an ideal centerpiece focal point.

    This terrarium is 5" tall by 5" wide and the opening is also 5" by 5". This glass cube has a triangle pane on one corner so you can place the terrarium on a square side or flip it on the triangle, making an attractive and intriguing display!

    Use as a vase to hold natural materials like sand, pearls, shells and greenery like moss, ivy and succulents. Foam Roses and Colorful Rose Petals look awesome and there's no mess or fuss! Use as a candle holder with Flameless LED Tea Lights, Votive Candles or Warm White Fairy String Lights. Lights and a touch of greenery look exceptionally chic in terrariums and it's a quick and easy combination that really looks awesome! Use U GLU Adhesive Dots to help keep materials in place.

    Plants are calming and comforting, lights are warming and welcoming. Combine both inside this geometric terrarium for an innovative, inviting and appealing display!]]>
    getecaho succulents-for-events flledcabaop
    Each cup is 3 1/4" tall and has a raised candle plate which allows you to get away with using a shorter candle. Because of the distinctive cut glass pattern, the light diffuses out and down. A small LED submersible light or a candle as short as 1 1/4" tall will produce light in an elegant pattern. These glass cups can also be filled with water pearls or water so you can float LED rose candles in them. Classy! White and amber light always look exceptional but if you prefer a change, colorful LED candles or colorful LED submersibles produce a dazzling effect against the geometric glass!

    These candles holders pair beautifully with crystal prism strands or in addition to a light source in the cups, you could also sprinkle in some diamond confetti or silk rose petals for extra pizazz. Classy, tasteful & upscale, you will be impressed with our Benita Geometric Glass Candle Holder Set!]]>
    hacaho flledcabaop
    wild-pagegolddecor11https://s.yimg.com/aah/shopwildthings/geometric-floral-display-nicola-gold-set-of-3-wire-frames-26.jpghttps://s.yimg.com/aah/shopwildthings/geometric-floral-display-nicola-gold-set-of-3-wire-frames-27.jpgSilk Florals, greenery sprays or flower balls. Add dimension with fairy string lights, hide submersible lights under foliage or use firefly pearls to emulate a summer night serenade. Decorate with faux moss, add a colorful butterfly or 2 or opt for Succulents, whose unique textures pair perfectly with geometric shaped vessels. Another outstanding use for these 3 exceptional frames is to create hanging floral decorations! It's a very trendy idea and also a great way to enhance the look of any room while creating lots of visual interest. "Nicola" does not come with hooks or hangers, but with so many angles on each frame, there are again, a multitude of ways in which they can be hung. Heavy twine or jute rope would complement these well. All of the framework makes it a cinch to attach the stems of cascading florals and simply filling with Greenery is enough to transform the look and feel of a room. Another feature is that the small and medium frames completely fit inside the larger frame, saving storage and transportation space!]]>vaflvaeitocy artificialgreenery silkflowers submersibleledwild-pagegolddecor11https://s.yimg.com/aah/shopwildthings/geometric-floral-display-builder-honeycomb-gold-set-of-4-metal-frames-80.jpghttps://s.yimg.com/aah/shopwildthings/geometric-floral-display-builder-honeycomb-gold-set-of-4-metal-frames-81.jpgSilk Florals, greenery sprays, flower balls or flower garlands, design just the look you're after. Other embellishments that pair perfectly with flowers while adding another design element are fairy string lights, Butterflies, crystal beaded strands and sparkling pendants. With the multitude of framework, there's no shortage of attachment areas for upright or cascading floral blooms. For a memorable floor or large tablescape centerpiece, buy several sets and tying the frames together, create a large yet elegant, geometric honeycomb display! Another outstanding use for these 4 versatile frames is to create hanging floral decorations! It's a very trendy idea and also a great way to enhance the look of any room while creating lots of visual interest. Heavy twine or jute rope would complement these well and a minimalist filling of